Cherry SNP DataBase

Gene information

Gene Pav_sc0001110.1_g250.1.mk
Chromosome name PAV_r1.0chr4
start 7002770
end 7010742
PAV_r1.0 name Pav_sc0001110.1
start 135545
end 143517
direction -
Annotation NR PREDICTED: probable lysine-specific demethylase JMJ14
Sequence CDS ATGGAACAGTTGAAATTAGCGGCAGAAGCTCAGCAAAAAGAGGATCATTCTTTTAAGAGC AACCAGAGAAGTGATGACGCACATGAGTGCTCAGGCAGTCCTCGAAGTCGAAAGATATCA GCTAGATGGGATCCGGATGAACCATGCAGGCCTGCCATTGATGAAGCACCTGTATTTTAT CCAACTATTGAGGAGTTTGAAGATACACTTGGTTACATAGCAAAGATACGCCTAGTGGCT GAATCTTATGGTATATGTCGGATTGTCCCGCCACCTTCCTGGACCCCTCCCTGCCCTCTT AAGGATAAAGAGATGTGGGAGCATGCTAAATTTTCCACACGTATTCAGCAAGTTGACTTG CTTCAAAACAGAGAAGCCATGAAAAAGAAAAGTAGAGGTCGGAAGCGAAAACGAAGGAGG CACTCAAGAATGGGAACCAAAAGACGATCAGAAGCTAATGTTGCTTCCGAGACTGATGAG AAGTTTGGGTTCCATTCAGGATCAGACTTTACATTTGAAGAGTTTCAGAGATATGCCTAT ACTTTCAAGGAGAGTTACTTCAGATCAAAGGATGCTAAGGAGGCTTCAAATTCTGGTGAA ACTAGAAGCAAAATATGGAAACCCTCTGTGGAAGACATTGAAGGTGAATACTGGCGAATA GTTGAGCAACCAACAGACGAGGTTGAGGTTTACTATGGAGCTGACTTGGAAACGGGAGTA TTTGGAAGTGGGTTTCCTAAGGCATCGTCTATGGTAACCGAAAATGATTTGGATCAGTAT GCAATGTCTGGTTGGAATCTAAATAATTTCCCACGCCTTCCTGGTTCTGTATTGTCTTTT GAAGCAAGCGACATCTCAGGAGTTCTAGTCCCATGGCTCTATGTTGGGATGTGCTTTTCT TCATTTTGTTGGCATGTTGAGGACCACCACCTCTATTCCCTAAATTATCTGCACTGGGGT GACCCAAAAGTTTGGTATGGAGTGTCTGGAAGCCGTGCTCAATCTTTGGAACGTGCAATG AGAAAGCATTTGCCAGATTTATTCGAGGAACAACCAGATTTACTCAATGAACTGGTCACT CAGCTATCTCCTTCAGTTTTAAAGTCTGAAGGTGTACCTGTGTATCGAGCTGTCCAACAT TCTGGGGAGTTTATTCTTACCTTTCCGAGGGCATACCATTCTGGATTTAATTGTGGCTTT AATTGTGCCGAGGCAGTGAATGTGGCCCCTGTTGATTGTCATAAATATGTCCTTCAACGC CACACTATCAGTGAATTAAATATGCTGGTTGAAGCATTGGAAGGGAGAATAGAAGCCATG AAAGTATGGGCATCCAAGGACCCTGTAGTAGTTTCTATAGACGATACTGATAGGCGTACT GCTAAGTTGGATCAAGAAAGTAGCATGTCTCATAAGAGAGTCAAGTCTTGTAATCCAAGG GAAACTTCATCTTGTTGCCCTGTTTCAGAAGAGAAGGTCAACATAAATGCATCTTGCAGT TCATCTAGTCAAGTTTCTTCTGCGGTTGTCCAGTCAGGGTCACAGCATGGAGCTTTTAGT TTAAGTGCATCTCACATCACTATGGATGGTCAAAATGACGATGAAACTCTGGCCATGAAT GACGAGGAAAAGATGGGGAATGAGTGCTGTTTTGATTTAAATCTTAATTATATGTCTGAT GAACGTGAAAGCAGGACGATGCACATATCTGATGACTTTGATAACAAGGCTGTCACAATT GAGGAGGATACATCTACATCCGTGTCTAATCAAGAGAAAGTTTGTAGTTCAGATGTAGCC AGAGACCCAGACATGATGAAAGTTGATAATGGCTACCCTGCCTGTTCAAGGGACATCAGG AATAGTTGTGCGAGTGATGGCAATAAGCTGTTCGGTGTTGAACTTTGCTTACCCCATCCT TCTTCAAACAAACAGTCAATAAACTTTTCAAAAACTGAAATTGTCGAGGACTCAGGTGTA AACATATCCTTGACTGACCAAAGCTATCAATTACAGAAGTTGAGTCCTTCGGTTGAGCCT ATAGATTTTGGGGCTGTTGTGTCTGGAAAGTTGTGGTGCAGTAAGCAGGCCATATATCCA AAAGGGTATAGAAGCCGAGTTAAATTTTATAGTGTGCTTGACCCAACAAAAGTTACTTTG GAAGAATGCCCCGGTGAGGCTTTTGCTAATGTATCGGCAGAGAAGTGCTGGGATATGGTA CTGCAGAGACTAAACCAAGAAATAAAGAGACGGAGTAGTCTAGGGGAAAGTGGACTGCCC CTTTTGCAGCCTAGCATTAATGGCCTTGAAATGTTTGGATTTCTCTCCCAACCCATTGTT GAGGCTATTGAGGCCCTCGATCCCGACCATCAATGTGTGGAGTACTGGAATTACAAGCGT ATCGTCCCATTGGCGTTTGGCAATGTTGGTGAAATCAAGCAGCATTCGTTTGAATCAAGT AGAAGTCTAGGAGAAACAGATACGAAAATTTTTGGTATTACTTTGACAAGGCAGGACCGG GATAATCCATCGGTGGAAGGAGATCATCCAACCGAAGAGATGCAGTTAGTGTTGCGAAGA CTATTAAAGAAGGCAGATTCCGAAGAGTTGAGGACATTACAGAGAGTATTGTGCAGTGAG TCACAAAGTTCAAAATGGAGAGTGGCATTCACATCCTTGATTGAAGAGATCCAGAGAAAT GTAGATAGTTAA
PEP MEQLKLAAEAQQKEDHSFKSNQRSDDAHECSGSPRSRKISARWDPDEPCRPAIDEAPVFY PTIEEFEDTLGYIAKIRLVAESYGICRIVPPPSWTPPCPLKDKEMWEHAKFSTRIQQVDL LQNREAMKKKSRGRKRKRRRHSRMGTKRRSEANVASETDEKFGFHSGSDFTFEEFQRYAY TFKESYFRSKDAKEASNSGETRSKIWKPSVEDIEGEYWRIVEQPTDEVEVYYGADLETGV FGSGFPKASSMVTENDLDQYAMSGWNLNNFPRLPGSVLSFEASDISGVLVPWLYVGMCFS SFCWHVEDHHLYSLNYLHWGDPKVWYGVSGSRAQSLERAMRKHLPDLFEEQPDLLNELVT QLSPSVLKSEGVPVYRAVQHSGEFILTFPRAYHSGFNCGFNCAEAVNVAPVDCHKYVLQR HTISELNMLVEALEGRIEAMKVWASKDPVVVSIDDTDRRTAKLDQESSMSHKRVKSCNPR ETSSCCPVSEEKVNINASCSSSSQVSSAVVQSGSQHGAFSLSASHITMDGQNDDETLAMN DEEKMGNECCFDLNLNYMSDERESRTMHISDDFDNKAVTIEEDTSTSVSNQEKVCSSDVA RDPDMMKVDNGYPACSRDIRNSCASDGNKLFGVELCLPHPSSNKQSINFSKTEIVEDSGV NISLTDQSYQLQKLSPSVEPIDFGAVVSGKLWCSKQAIYPKGYRSRVKFYSVLDPTKVTL EECPGEAFANVSAEKCWDMVLQRLNQEIKRRSSLGESGLPLLQPSINGLEMFGFLSQPIV EAIEALDPDHQCVEYWNYKRIVPLAFGNVGEIKQHSFESSRSLGETDTKIFGITLTRQDR DNPSVEGDHPTEEMQLVLRRLLKKADSEELRTLQRVLCSESQSSKWRVAFTSLIEEIQRN VDS


| Top |