Cherry SNP DataBase

Gene information

Gene Pav_sc0001110.1_g280.1.mk
Chromosome name PAV_r1.0chr4
start 6979047
end 6985775
PAV_r1.0 name Pav_sc0001110.1
start 160512
end 167240
direction -
Annotation NR PREDICTED: UDP-arabinose 4-epimerase 1
Sequence CDS ATGCTAAATTTTGGCAGGGCCAGAAGTCAGTCAAGGACCAATAGATCCATGTCTCTTGGA GGAATGGATTATCCAGATCCCAAGAGGAAGAACAATTTCGTAGGAAAAATTCTTCTGGCT GCTACCCTTACAGCATTATGCATTATCATGCTGAAACAGTCCCCATCTTTCAATACCCCA AGCATGTTCTCCCTTCATGAATCAGGGGTAACCCATGTCCTAGTAACAGGAGGTGCTGGA TTTATTGGTTCACATGCTGCATTGCGACTTCTGAAGGATTCATATCGTGTAACTATCGTG GATAACCTCTCACGGGGAAACCTAGGTGCAATTAAGGTTCTCCAAGAACTATTTCCTGAA CCTGGAAGGCTTCAGTTTATTTATGCTGACTTGGGGGATGCAAAATCCGTTAACAAAATT TTTTCAGAAAATGCCTTTGATGCTGTGATGCATTTTGCAGCTGTTGCATACGTGGGGGAA AGCACCCTTGATCCACTTAAGTATTACCACAATATTACGTCGAATACCTTGGTGGTTTTG GAGTCAATGGCTACACATGGTGTGAAGACTTTGATATATTCTAGTACATGTGCAACATAT GGGGAACCTGAAAAGATGCCTATTACTGAAGAAACTCCACAGGTCCCAATTAATCCATAT GGAAAAGCTAAGAAGATGGCAGAAGATATTATCTTGGATTTCTCTAAGAATTCAGACATG GCAGTCATGATCCTCAGGTACTTCAATGTGATTGGGTCGGATCCAGAGGGCAGATTAGGC GAAGCTCCCAGACCTGAGCTTCGTGAGCATGGACGAATATCAGGTGCTTGTTTTGATGCA GCTCGCAGCATTATTCCTGGGCTAAAGGTTAGAGGTACAGATTATAAAACATCTGATGGC ACTTGCATAAGGGACTATATAGATGTCACTGATTTGGTTGATGCTCATGTGAAAGCTCTT GAGCATGCACAGCCCCGTAAAGTGGGAATCTACAATGTTGGCACTGGAAAAGGTAGTTCA GTAAAGGAGTTCGTGGAGGCTTGCAAGAAGGCAACTGGGGTGGACATCAAAGTTGATTTC CTTCCCCGTCGGCCTGGCGACTATGCTGAGGTCTATAGTGACCCATCTAAGATCCTGCGT GAACTCAACTGGACAGCTCAACACACCAATCTTCAAGAGAGTTTGCAGATTGCGTGGAGA TGGCAAAAGTCACACCGTGATGGGTACGGAATCCCGTTGGCGATGTATTCTTGA
PEP MLNFGRARSQSRTNRSMSLGGMDYPDPKRKNNFVGKILLAATLTALCIIMLKQSPSFNTP SMFSLHESGVTHVLVTGGAGFIGSHAALRLLKDSYRVTIVDNLSRGNLGAIKVLQELFPE PGRLQFIYADLGDAKSVNKIFSENAFDAVMHFAAVAYVGESTLDPLKYYHNITSNTLVVL ESMATHGVKTLIYSSTCATYGEPEKMPITEETPQVPINPYGKAKKMAEDIILDFSKNSDM AVMILRYFNVIGSDPEGRLGEAPRPELREHGRISGACFDAARSIIPGLKVRGTDYKTSDG TCIRDYIDVTDLVDAHVKALEHAQPRKVGIYNVGTGKGSSVKEFVEACKKATGVDIKVDF LPRRPGDYAEVYSDPSKILRELNWTAQHTNLQESLQIAWRWQKSHRDGYGIPLAMYS


| Top |