Cherry SNP DataBase

Gene information

Gene Pav_sc0001124.1_g250.1.mk
Chromosome name PAV_r1.0chr3
start 247620
end 249858
PAV_r1.0 name Pav_sc0001124.1
start 150955
end 153193
direction -
Annotation NR PREDICTED: ABC transporter E family member 2-like isoform X3
Sequence CDS AAATTATGCATTGAGGTCAAACCTGTGTCCAAGGTTGCTCGTATCTCCGAAGAGTTGTGC ATTGGCTGTGGTATATGTGTTAAGAAATGCCCATTTGGAGCAATTGAAATCATCAACTTG CCAAAGGCACTGGACAAAGACACAACCTATCGCTATGGGTCTAACTCTTTTAAATTACAC AGGTCAAATCCTCCAAATTGGCAGGAAATCTTGACTTACTTTCGAGGATCGGAGCTGCAA AGTTATTTTATTCGTCTCTTGGAAGATAAGTTGAAGGCTGTTATAAAACCCCAATACGTT GACCACATTCCAAAAGTAGCTGAAGGCAATGTAGGGGAGTTGCTCAAACAGAAAGATGAG AGGGGTGTGATGGAAGAAGTCATTGTTGATCTTGAGCTAAACCAGGTTCTAGATCGTAAC GTAGTCAATTTATCTGGTGGGGAGCTTCAAAGATTCGCTGTTGCTTTTCTTGCTTCGCAA AAGGCAGATATATACATGTTTGATGAACCTTCAAGTTATCTTGATGTGAAACAAAGGCTT AAAGCTGCCAAAGTCATCCGATCTTTGATCAGGCCTGATAGCTATGTAATCGTTTCTGAG ACTCCACAAGAAAGCGGTGAGGAAGTTGAGACATATGCACGGTATAGATACCCATCGATG ACTAAAACGTTGGGAGAGTTCAAGCTTCAAGTTATAGAGGGCGAATTTAGCAATTCTCAA ATTATTGTGATGTTGGGTGAGAATGGATCCGGGAAGACTACATTTATGAGAATGCTGGTT GGCCTATTGAAACCTGATTCTGATGTGGAGATACCTGAGCTTCATGTTTCCTACAAAACC CAGAAAATTAATACAAAGCGTGCAATAAAAGTCAAAGACATGCTTCATGAAAAAATTCGC AATTCTTGTACACATCCCCAGTTTGTGACAGACGTGATGAAGCCTCTCCAAATTGGGCAA TTAATGGATCAAGATGTTACCAAACTCTCTGGTGGAGAGCTGCAAAGGGTTGCTCTATGT GTATGCCTTGGA
PEP KLCIEVKPVSKVARISEELCIGCGICVKKCPFGAIEIINLPKALDKDTTYRYGSNSFKLH RSNPPNWQEILTYFRGSELQSYFIRLLEDKLKAVIKPQYVDHIPKVAEGNVGELLKQKDE RGVMEEVIVDLELNQVLDRNVVNLSGGELQRFAVAFLASQKADIYMFDEPSSYLDVKQRL KAAKVIRSLIRPDSYVIVSETPQESGEEVETYARYRYPSMTKTLGEFKLQVIEGEFSNSQ IIVMLGENGSGKTTFMRMLVGLLKPDSDVEIPELHVSYKTQKINTKRAIKVKDMLHEKIR NSCTHPQFVTDVMKPLQIGQLMDQDVTKLSGGELQRVALCVCLG


| Top |