Cherry SNP DataBase

Gene information

Gene Pav_sc0001124.1_g260.1.mk
Chromosome name PAV_r1.0chr3
start 235378
end 246650
PAV_r1.0 name Pav_sc0001124.1
start 154163
end 165435
direction +
Annotation NR PREDICTED: uncharacterized aarF domain-containing protein kinase 1 isoform X1
Sequence CDS ATGCGGAAGGCCAAAACCGCACTCTGCTTAATCACAGCCACTGGCCTCACCTTTCATGCC TTCAACCCCAATTTTCTATCATCTTCCTCCGATTCCTTCCCCAACTTTCCTGAGAAATTA CGCGCACCAATCCATGGCGTCAATCGATCTTCTCGCGCAATCGCCACCATTGCTTTCACT GCTGTTGACTACAAGTTCACTTTACATGGACTCTCGGTTGACTCTGATGAGTATCGTCAG AAGCTATCTGAGGTTCATAGAAGGTCCGCCACGAGAATTCGGAAATTGTGTGAGGTCAAT AGAGGGTTCTATGTGAAAGCTGGCCAATTTGTTGCAGCTTTGCGACAGGTTCCCAAGGAA TACTCATTAACTCTTTCCTCATTGCAGGATCAGGCAGTTCCTTATCATTTCAAGGCTATT AAAGAGGTACTAATCCGCAATCTGGGACCCGAGCTGTCAGATATATTTTTGTCACTCGAT GAACATCCGATAGCTGCTGCATCTATTGCTCAAGTACACCGGGGAGTTCTTAAGGGTCAT CAAGAAGTAGCAATTAAGGTGCAGTACCCGGGGCTGGAGCAGCAAATGAAAATAGATGCA ACAACCATGTATTTTCTTTCAAAATCCCTTGCTTGGACTTTATTCAGGAGGCTAGGAATT CTGAGACAACTGCCAATAACTTTGCCAACAACAAATGGGTCAAGGTTCCTCGTGTATTTT GGGACTTAA
PEP MRKAKTALCLITATGLTFHAFNPNFLSSSSDSFPNFPEKLRAPIHGVNRSSRAIATIAFT AVDYKFTLHGLSVDSDEYRQKLSEVHRRSATRIRKLCEVNRGFYVKAGQFVAALRQVPKE YSLTLSSLQDQAVPYHFKAIKEVLIRNLGPELSDIFLSLDEHPIAAASIAQVHRGVLKGH QEVAIKVQYPGLEQQMKIDATTMYFLSKSLAWTLFRRLGILRQLPITLPTTNGSRFLVYF GT


| Top |