Cherry SNP DataBase

Gene information

Gene Pav_sc0001124.1_g320.1.mk
Chromosome name PAV_r1.0chr3
start 181590
end 184938
PAV_r1.0 name Pav_sc0001124.1
start 215875
end 219223
direction +
Annotation NR PREDICTED: LOW QUALITY PROTEIN: protein REVEILLE 1
Sequence CDS ATGGTGGGTGGATTAATGCTCTCTCCAGATATGGCTGCTGCTCAAGATCAATATGATGGT AGTCGTTCAGAAAGTGTTCTCTCAGCAAACAATGGGGTTTCATTTAGTGCTTCTGGGCTC CAGTTGAAGGATCAGTTCTCTAATGGAAATGACTCTGCTCCCAAGGCGAGAAAACCATAC ACAATCACAAAACAAAGAGAGAGATGGACAGAGGAAGAGCATAAGAAATTCCTTGAAGCT TTAAAGCTGTATGGTCGAGCCTGGCGAAAGATAGAAGAGCATGTTGGCACCAAGACTGCA GTTCAGATTCGAAGTCATGCTCAAAAGTTCTTTTCTAAGGTTGCTCGTGACTCAAATGGC AGCAACGTAATCTCGGAAGAGCCCATTGACATCCCTCCTCCTCGACCAAAACGGAAGCCA ATGCGTCCTTATCCCCGAAAACTTGTACACCCTGTTAATAAAGAGACCTTTATTGTAGAG CGGCCAACAAGGTCTGCATCTCCAAATTTATCAGTTTCGGAGCCAGAAAACCAGTCTCCA ACATCAGTATTATCTGTGATTGGCTCAGATACACTGGGTTCCGCTGATTCAAATACACCC AGTCGTAGTTTATCACCCGTTTCATCTGCTGCTGATGTCCATGGTGTGGACTTAAATCAT TCTGAGCCCCCCAACCCATCACTGGAGGAAAGTGGATCTACATCACCATCTGTAGCAGAA AATGGTTCACTTCCTAACATGCAATTATCAATGAAGCTTGAGTTATTTCCCACGGATAAT GTTGCTGCTAGTGGAGTTTCAGCTGAGGAGGTATCCGCACGAAGCCTTAAACTCTTTGGA AGAACTGTATTGGTCACGGATTCCTACAGACCATCTTCTCCAACCTCGGGAACTTCAAAA TCACTGCCTTCTGATGTGAAAGAGGAGAAACCTGTGCAGACATCAACACCATGTAACTTT ACAGCTACAGAATCTGCATCTGGGAGTGTGGAACATGTTTGGGATAATTTTCCCTATGGA GTACATCCAGGCATGTATTTTATGCAATTTCAGAATCAGAACTCAAATCTGGTAGAATCT GGTTCTGCTTATTCTGCACCATGGTGGACCTTATGTCCAAAATTGCCATTTCCTTTTATT CCATTCCATAAGCCGCAAGCAGTAAAAGAACATTTTGATGGTAATCTTGGAGATCCTAAG GAAGTTGAGAAGGAAGGGTCTTGGACTGGTTCAGATGCTGGATCAGTCAATGATGAGGAA AACGGTGACAAATGTCTAGGTATTGAGACTGAGGGTAAAGAACAAGAGCCAAATTCGGTT CTCCAATTTAAGGCAAGTGCAAACTCAGCCTTCTCTGAATTAAGAGCAAGCCCTAGCCCT GGAAAGTGTAGAAAAGGATTTGTACCGTATAAAAGATGTTTGGCTGAGAGAGACACCTCT ACAATAGCAAGTGAAGACAGGGATGGGAAAAGAGTCCACCTTTCCTTGTAA
PEP MVGGLMLSPDMAAAQDQYDGSRSESVLSANNGVSFSASGLQLKDQFSNGNDSAPKARKPY TITKQRERWTEEEHKKFLEALKLYGRAWRKIEEHVGTKTAVQIRSHAQKFFSKVARDSNG SNVISEEPIDIPPPRPKRKPMRPYPRKLVHPVNKETFIVERPTRSASPNLSVSEPENQSP TSVLSVIGSDTLGSADSNTPSRSLSPVSSAADVHGVDLNHSEPPNPSLEESGSTSPSVAE NGSLPNMQLSMKLELFPTDNVAASGVSAEEVSARSLKLFGRTVLVTDSYRPSSPTSGTSK SLPSDVKEEKPVQTSTPCNFTATESASGSVEHVWDNFPYGVHPGMYFMQFQNQNSNLVES GSAYSAPWWTLCPKLPFPFIPFHKPQAVKEHFDGNLGDPKEVEKEGSWTGSDAGSVNDEE NGDKCLGIETEGKEQEPNSVLQFKASANSAFSELRASPSPGKCRKGFVPYKRCLAERDTS TIASEDRDGKRVHLSL


| Top |