Cherry SNP DataBase

Gene information

Gene Pav_sc0001124.1_g380.1.mk
Chromosome name PAV_r1.0chr3
start 131119
end 141001
PAV_r1.0 name Pav_sc0001124.1
start 259812
end 269694
direction -
Annotation NR PREDICTED: sucrose synthase 7-like
Sequence CDS ATGGCTTCAGGAGCAGCCATCAAACGATCCGAGTCCATAGCTGAGAGCATGCCGGAAGCC CTGAGGCAGAGCCGGTACCATATGAAGAGGTGCTTTGCTAAGTACATTGAGAAAGGAAAA AGGATAATGAAGCTTCCCCATTTGATGAGTGAAATGGAGACAGTCATAGATGACAAGGTT GAAAGAAACCAAGTCTTGGAGGGAGTGCTTGGCTATATTTTGTGTTCAACTCAGGAAGCT GTTGTTATTCCTCCATTTGTTGTCTTTGCCATAAGACCAAATCCAGGGTATTGGGAATTT GTTAAAGTCAGTTCTGAGGATCTCTCAGTTGAGTCCATCACTGTCAGAGACTACTTGAAA TTCAAAGAAACTTTATATGATGAGAAATGGTCAAATGATGAAAATGCATTGGAGGTGGAT TTTCGAGCAATTGACTTCTCAACTCCTCACTTAACTCTATCTTCCTCTATTGGAAATGGA CTCAATTTTGTTTCCAAGTTCACCAGTTCAAAGCTAGCTGGGAGATTGGAGAATGCACAG CCCCTTGTGGATTATTTACTTTCACTAAATCATGAAGGAGAAAATCTTATTCTAAATGAG AACCTCAACACTGCCTCAAAGCTTCAGACGGCACTGATTGTAACAGAAGTGTACCTCTCA GCGCTTCCCAAAGACATGCCGTACCACAATTTCGAACTAAGGTTCAAGGAGTGGGGCTTT GAGAAGGGTTGGGGAGATACCGCAGAAAGAACTAAGGAGACAATGAAACTACTTTCAGAA GTACTACAAGCTCCAGACCCGTTGAACTTGGAAAGGTTTTTCAGCAGACTTCCAACAATA TTCAATGTTGTAATATTCTCTCCTCATGGCTACTTTGGCCAAGCAGATGTTCTTGGCTTG CCAGACACCGGTGGGCAGGTAGTTTATATTCTGGATCAAGTGCAAGCTCTGGAAGAGGAA CTGCTCCTCAGAATTAAGCAACAAGGGCTTACTGTGAAGCCTCAAATTCTTGTGGTAACA AGACTCATACCTGAAGCAAAGGGAACTAAGTGCAACCAGGAGTTGGAACCGATCAATGGC ACTAAGTACTCTAACATTCTTAGGGTGCCATTTAGGACAGAAAAGGGGATCCTACGGCGC TGGGATGCTTCTGCAAAAGTCCTCGACATTATGGAAGGAAAGCCAGATCTTATTATTGGA AACTATAGTGATGGGAATTTAGTGGCATCTCTCATGGCTAATAAACTAGGGATTACTCAG GCAACTATTGCTCATGCCTTGGAGAAGACCAAATATGAAGATTCAGACATCAAGTGGAAG GAATTAGATCCTAAGTATCACTTCTCATGCCAATTTCTTGCTGACACAATTTCAATGAAT GCCACAGATTTTGTCATAGCAAGCACATACCAGGAAATTGCAGGAAGCAAAGACAGACCA GGACAATACGAAAGCCATACTGCATTTACACTGCCAGGGCTCTGTAGAGTTGTTTCAGGC ATCAATGTATTTGATCCCAAATTTAACATTGCTGCACCGGGGGCCGATCAGTCTGTCTAT TTCCCCTATACAGAGAAGCAGAAACGGCTCACATCATTTCATCCTGCCATCGAAGAACTG CTGTATAGTAAAGAGGATAACAGTGAACATATAGGATTTCTAGCAGACAGGAAGAAACCT ATCATCTTCTCAATGGCAAGGCTTGACACTGTTAAAAACATTACTGGTTTGGTTGAGTGG TATGGTAAAAACAAGAGGCTGAGAAATTTGGTTAACCTTGCTGTAGTTGGGGGGTTCTTT GACCCTTCAAAATCAAAAGATAGAGAAGAAATTGCAGAAATAAAAAAGATGCATACACTG ATAGAAAAGTACCAGCTTAGGGGCCAGATCAGATGGATAGCTGCACAGACTGATAGGAAC CGAAATGGAGAACTCTACCGTTGTATTGCTGACACAAGGGGAGCTTTTGTGCAACCTGCC CTCTATGAAGCCTTTGGTCTTACTGTCATAGAGGCAATGAACTGTGGACTGCCCACCTTT GCAACCAACCAAGGAGGCCCAGCTGAAATCATTGTGGATGGGATCTCCGGTTTCCATATT GATCCCAACAATGGTGATGAAGCAAGCAACAAAATTGCTGATTTCTTTGAGAAGTCCAAG ACTGATGCTACATACTGGGACAGGTTTTCGAAAGCAGGTTTGCAGCGAATATACGAATGC TACACTTGGAAGATATATGCAAACAAGGTGTTGAACATGGGGAGCACTTATACTTTCTGG AGGCAGTTGAACAAAGAGCAGAAACAAGCTAAACAAAGATACATCCAGATGTTCTTTAAT CTCCAGTATCGGAACTTGGTGAAGAATGTGCCTATCCCAAGTGATGAGGCTGAACAACCA GTGCCAAAGCCAACTGCCAAATCACAGCCCACACCAAGGCATCACAAGACGCTCACAGTC TCGATTGCAAAGGTAAAGAGTAAGATCCCTACAATTAGGAAGGGGATCGTGGAGATGGAT AAATTAGGATCAATGAGCAAAGATGGAGCCTCATCTTCCTCTACCAAAAGGAAGTCCAGA AGACCCAAATATTCCAAGTTCACACAGCAAGAGCTTCCAGCTTGCAAACCAATTTTAACA CCAGGATGGGTCATTTCTATATTTGTCACAATCGGCATTATCTTTATCCCTATTGGCTTT GCTTCCTTATTTGCATCAGAGCGTGTGGTGGAAATTGTGGACCACTATGACAAAGATTGT GTTCCTCTTAGATATACGGACGATAAGCTTGCATTTATTCAGAATAGTAAAACTAACAAG ACCTGTATTAGGAGACTAACTGTTCCAAAACAAATGAAATCTCCCGTTTACATCTACTAC CAGCTTGATCATTTCTATCAGAATCATCGCCGATATGTTAAAAGTAGGAGTGACAGTCAG TTGCGGAGCAAGTCTGATGAGAATACAACAAGCAACTGTGCTCCTGAACGCAATTCACCA AATGGTGCAATTGTTCCCTGTGGTCTGATTGCATGGAGTTTGTTTAATGACACATACAAG TTTTCAGTGAAAAACAAACAACTGGGGGTCAACAAAAAGGACATCACATGGAAAAGTGAC AAGGGGAATAAGTTCGGCTCGGATGTCTATCCTAAAAATTTCCAGAGTGGGGGTTTGATT GGAGGAGCAAAACTGAATTCTAGCATACCTCTGAGTGAACAAGAAGATCTTATTGTTTGG ATGCGGACTGCAGCACTGCCAACGTTCAGAAAACTATATGGGAGGATAGAAGTGGACCTT GAAGCTAATGATGTAGTAATTGTAACAATAGAGAATAATTATAACACCTACAGCTTCGGT GGCAACAAGAAGCTCGTACTTTCAACCGCAAGCTGGATTGGTGGAAAGAATTATCTGCTA GGCATAGCATACCTTACTGTTGGCGGACTCTGTTTGTTCTTGGCTATAAGCTTCATACTT CTATATTTGATAAAGCCAAGGCCTCTTGGGGATACATCCTACTTGTCTTGGAACAGAAGT GCATCAGGAGTACATATATTTACTAGCTAG
PEP MASGAAIKRSESIAESMPEALRQSRYHMKRCFAKYIEKGKRIMKLPHLMSEMETVIDDKV ERNQVLEGVLGYILCSTQEAVVIPPFVVFAIRPNPGYWEFVKVSSEDLSVESITVRDYLK FKETLYDEKWSNDENALEVDFRAIDFSTPHLTLSSSIGNGLNFVSKFTSSKLAGRLENAQ PLVDYLLSLNHEGENLILNENLNTASKLQTALIVTEVYLSALPKDMPYHNFELRFKEWGF EKGWGDTAERTKETMKLLSEVLQAPDPLNLERFFSRLPTIFNVVIFSPHGYFGQADVLGL PDTGGQVVYILDQVQALEEELLLRIKQQGLTVKPQILVVTRLIPEAKGTKCNQELEPING TKYSNILRVPFRTEKGILRRWDASAKVLDIMEGKPDLIIGNYSDGNLVASLMANKLGITQ ATIAHALEKTKYEDSDIKWKELDPKYHFSCQFLADTISMNATDFVIASTYQEIAGSKDRP GQYESHTAFTLPGLCRVVSGINVFDPKFNIAAPGADQSVYFPYTEKQKRLTSFHPAIEEL LYSKEDNSEHIGFLADRKKPIIFSMARLDTVKNITGLVEWYGKNKRLRNLVNLAVVGGFF DPSKSKDREEIAEIKKMHTLIEKYQLRGQIRWIAAQTDRNRNGELYRCIADTRGAFVQPA LYEAFGLTVIEAMNCGLPTFATNQGGPAEIIVDGISGFHIDPNNGDEASNKIADFFEKSK TDATYWDRFSKAGLQRIYECYTWKIYANKVLNMGSTYTFWRQLNKEQKQAKQRYIQMFFN LQYRNLVKNVPIPSDEAEQPVPKPTAKSQPTPRHHKTLTVSIAKVKSKIPTIRKGIVEMD KLGSMSKDGASSSSTKRKSRRPKYSKFTQQELPACKPILTPGWVISIFVTIGIIFIPIGF ASLFASERVVEIVDHYDKDCVPLRYTDDKLAFIQNSKTNKTCIRRLTVPKQMKSPVYIYY QLDHFYQNHRRYVKSRSDSQLRSKSDENTTSNCAPERNSPNGAIVPCGLIAWSLFNDTYK FSVKNKQLGVNKKDITWKSDKGNKFGSDVYPKNFQSGGLIGGAKLNSSIPLSEQEDLIVW MRTAALPTFRKLYGRIEVDLEANDVVIVTIENNYNTYSFGGNKKLVLSTASWIGGKNYLL GIAYLTVGGLCLFLAISFILLYLIKPRPLGDTSYLSWNRSASGVHIFTS


| Top |