Cherry SNP DataBase

Gene information

Gene Pav_sc0001124.1_g400.1.mk
Chromosome name PAV_r1.0chr3
start 111839
end 117553
PAV_r1.0 name Pav_sc0001124.1
start 283260
end 288974
direction +
Annotation NR PREDICTED: probable polyamine oxidase 4
Sequence CDS ATGCCAATCCCAATGGACCCAAAAGATTTTTTCTCTACTGATTTTCTGGAAGGCTCTATT TCGTCTCACATTGGGAGGCAGCACAATGCTTGCCCTTCTGTTATTGTCATTGGTGGTGGT ATATCAGGGATTGCAGCTGCACGTGTTCTCCATGATGCATCTTTTAAGGTTATCTTGCTG GAATCACGAGACAGACTTGGTGGCCGGATTCATACTGACTACTCATTTGGTTGTCCAGTA GATATGGGAGCATCATGGCTACATGGTGTTTGCAATGAGAATCCCTTGGCTCCACTGATA CGCCGTCTAGGACTTACTTTATACCGTACGAGTGGTGACGACTCTGTATTGTATGATCAT GATTTGGAAAGCTATGCACTTTTTGATATGGATGGCCGCCAAGTTCCTCAAGAGATGGTC ATTGAAGTTGGTGATACTTTCAAGCAAATTCTCAAAGAGACCGAGAAAGTACGGAATGAG AATACTGATGACATGTCTGTCTCTCAAGCAATTTCTATTGTGATGGATAGGCATCCAGAA TTAAGACAAAACGGACTTGCTCACGAAGTGTTACAATGGTACATATGTCGAATGGAAGCA TGGTTCGCTGCAGACGCAGATGTGATATCGCTAAAAAACTGGGATCAGGAGCATGTTCTT TCTGGTGGCCATGGACTTATGGTGCAAGGCTATGACCCAATAATAAAGGCTCTTGCAAAA GATATTGATGTACGCTTGAATCACAGGGTTACAAAGATATTAAATGGGCATAACAAGATG ATGGTCACAATTGAAGACGGAAGAAACTTCGTTGCTGATTCAGCTATAATAACAGTACCC CATGGGATTCTTAAAGCCAAGATGATTGAGTTCGAACCAAAGTTGCCTGAGTGGAAGGTT GATGCAATTTCAGATCTTGGGGTGGGCAATGAAAACAAAATTGCCTTGCGATTTGAAACA GTTTTCTGGCCAAATGTAGAGCTCTTAGGCGTTGTTGCACCAACTTCTTATGCATGTGGT TATTTTCTCAATCTTCATAAGACCACAGGCCATCCGGTCCTTGTCTATATGGCTGCTGGA AGGTTTGCATACGACCTTGAAAAATTAACTGATGATGGCGCAGTTAGTTTTGTTATGTTG CAGCTTAAGAAGATGTTACCTGATGCAACTGATCCAGTTCAATATCTTGTATCACGTTGG GGAACAGACCTGAATTCTCTTGGATGCTACTCGTTGGATTTGGTTGGAAAGCCTGGAGAT ATATATGATAGGCTTCGAGCACCTTTGGGCAGTCTTTTCTTTGGAGGTGAAGCTGTTAGC ATGGACCACCAAGGATCTGTGCATGGAGCTTACTCAGCTGGAGTTATAGCTGCTGAGGAC TGTCAGAGACATCTCCTAAATAAATTTGGTAGACTGGAAAGGCTTCAGCATGCTTACATT ACTGATGAAGTCCTCGAAGCAACAGTTCCCCTGCAAATCTCAAGGATGTGA
PEP MPIPMDPKDFFSTDFLEGSISSHIGRQHNACPSVIVIGGGISGIAAARVLHDASFKVILL ESRDRLGGRIHTDYSFGCPVDMGASWLHGVCNENPLAPLIRRLGLTLYRTSGDDSVLYDH DLESYALFDMDGRQVPQEMVIEVGDTFKQILKETEKVRNENTDDMSVSQAISIVMDRHPE LRQNGLAHEVLQWYICRMEAWFAADADVISLKNWDQEHVLSGGHGLMVQGYDPIIKALAK DIDVRLNHRVTKILNGHNKMMVTIEDGRNFVADSAIITVPHGILKAKMIEFEPKLPEWKV DAISDLGVGNENKIALRFETVFWPNVELLGVVAPTSYACGYFLNLHKTTGHPVLVYMAAG RFAYDLEKLTDDGAVSFVMLQLKKMLPDATDPVQYLVSRWGTDLNSLGCYSLDLVGKPGD IYDRLRAPLGSLFFGGEAVSMDHQGSVHGAYSAGVIAAEDCQRHLLNKFGRLERLQHAYI TDEVLEATVPLQISRM


| Top |