Cherry SNP DataBase

Gene information

Gene Pav_sc0001129.1_g050.1.mk
Chromosome name PAV_r1.0chr2
start 3279560
end 3286454
PAV_r1.0 name Pav_sc0001129.1
start 27156
end 34050
direction +
Annotation NR PREDICTED: ATP-dependent Clp protease proteolytic subunit 3, chloroplastic
Sequence CDS ATGATGACTTACGCAGCCTCAGCTTCAAGGCCACTGTGTTCTATTAATGGCGCTTCACAA ACCCAAGTACCGATGTCACCCATTGTGAAGAGCAGTGGTCTTAATAGCAGTAGCAATAGT ATTAGTTGTCGTAGAAGAAGCAAAGGCGTGTGTGTAATTAAGGCCTTAAAAAGCTCTTCG CCCCCAAGACAGACCTTGTCGAGCAATTGGGATTTTCAGACAGCAACTACGTCATCTCCA CGGCTGCCCAGATTCGAAGAGCTGGATACTACCAATATGCTTCTCCGTCAGAGAATCATC TTTCTGGGTTCTCAGGTAGATGACATGACAGCAGATTTGATTATAAGCCAACTTCTGTTT CTAGATGCTGAGGACCCAAAGAAGGACATTAAATTGTTTATCAATTCACCTGGTGGTTCT GTTACCGCTGGAATGGGAATATATGATGCAATGAAATTGTGCAAGGCAGATGTTTCAACA GTTTGTCTGGGGCTTGCTGCTTCTATGGGGGCATTTCTCCTTGCTGCTGGGACAAAAGGA AAAAGATACTGCATGCCCAATGCAAGAGTGATGATCCATCAACCTCTTGGAACTGCAGGG GGCAAAGCAACAGAAATGGGTATACGAATTAGAGAAATGGTGTACCACAAGATTAAATTG AACAAAATATTTTCAAGAATCACAGGGAAGCCTTTGGAGCAGATTGAAGAGGACACGGAC CGTGATAATTTCATGAATCCTTGGGAAGCCAAGGACTATGGGTTGATTGATGTAGTTATT GATGATGGAAAGCCAGGCTTAGTTGCTCCGATTGGAGATTCCATAACTCCGCCCAGAACA CGAGTTTGGGATCAGTGGAAAGTTGAAGGGACAAAGAAAGCCAGAAAGAATTTGCCCTCA GAGCAAAGGATTTCGGATAATGGATATAAAGAGACTGAAGGAAGTGACAATGAGAAAGGA GCCGAGAGGGAAAAGGAAGAACCTGCTGCTATATGA
PEP MMTYAASASRPLCSINGASQTQVPMSPIVKSSGLNSSSNSISCRRRSKGVCVIKALKSSS PPRQTLSSNWDFQTATTSSPRLPRFEELDTTNMLLRQRIIFLGSQVDDMTADLIISQLLF LDAEDPKKDIKLFINSPGGSVTAGMGIYDAMKLCKADVSTVCLGLAASMGAFLLAAGTKG KRYCMPNARVMIHQPLGTAGGKATEMGIRIREMVYHKIKLNKIFSRITGKPLEQIEEDTD RDNFMNPWEAKDYGLIDVVIDDGKPGLVAPIGDSITPPRTRVWDQWKVEGTKKARKNLPS EQRISDNGYKETEGSDNEKGAEREKEEPAAI


| Top |