Cherry SNP DataBase

Gene information

Gene Pav_sc0001181.1_g240.1.mk
Chromosome name PAV_r1.0chr1
start 24997238
end 24998521
PAV_r1.0 name Pav_sc0001181.1
start 109087
end 110370
direction +
Annotation NR PREDICTED: putative zinc finger protein At1g68190
Sequence CDS ATGGAGAAAGCTTGTGAGTTGTGCTTAGAGCTAAGGCCAGTTGTGTACTGCAAAGCTGAT TCAGCACATCTGTGCCTTCCCTGCGATGCAAAGGTTCATTCTGCTAACCCAATTGTTGGC TACCATCACCGAACCCTTCTATGTGATTCGTGCAAATACCGGTCGGCGGATATCCAGTGT TTGGATCACCGGATGTTTATGTGCCGTGTATGTGACGTGAGCCTGCACAGGAAGTGCTCT CCCCATGGCCAGCATCGGAAACGGACGTTGGTCAGCAGTTTCACAGGTTGCCCATCTGCC AAGGACTTTGCAGCATTTTGGGGTTTCAAATTGGATGAATCTGATGGAGTGGGATCAAAC AGTCAAAGATTTAAGAAGATATCTCATGGTCATGGTCATGGAGGTCACTATCAGAAAAGA AGTACTGGCAATAGTTTGATTCTGGACCAGATTCTTGACTTGAAAAGGCTTCAGCTGAGT CAAGATCAACCAAATCAAGAGAAATCTTCTTCAGTGCATGAACATCAAAACCCTTCAAGG AGGTTGGAACATAGTCTTGATCATCATCATTTACAACATTCCCAGGATGATCTCGGCCGC ATTGGATCTCAGCAAAGGGACAGCTGTCTACCTGATCAGGGCACTGCAGGATTTCTATTG CATACAGAATCATTTGGGCAGGGTAGAAGCACAGTGCAGAATAGTCCGCTGTGGTCTCAA AATATGCAAGACCTTGGGGTTTGTGAAGAACAAGCTTATGATCATCAAGATCCCAATACA CCTGATGTCGATTCGACATTCCGAAACTTCGAGGAATCATTTGGAGGTGATCAGCAAGAT GTGTCATACTCCTTCATGGAGAAGAAGGGCCATGCAAGAGCAGCCAAGAAATAA
PEP MEKACELCLELRPVVYCKADSAHLCLPCDAKVHSANPIVGYHHRTLLCDSCKYRSADIQC LDHRMFMCRVCDVSLHRKCSPHGQHRKRTLVSSFTGCPSAKDFAAFWGFKLDESDGVGSN SQRFKKISHGHGHGGHYQKRSTGNSLILDQILDLKRLQLSQDQPNQEKSSSVHEHQNPSR RLEHSLDHHHLQHSQDDLGRIGSQQRDSCLPDQGTAGFLLHTESFGQGRSTVQNSPLWSQ NMQDLGVCEEQAYDHQDPNTPDVDSTFRNFEESFGGDQQDVSYSFMEKKGHARAAKK


| Top |