Cherry SNP DataBase

Gene information

Gene Pav_sc0001181.1_g650.1.mk
Chromosome name PAV_r1.0chr1
start 25178361
end 25179821
PAV_r1.0 name Pav_sc0001181.1
start 290210
end 291670
direction -
Annotation NR PREDICTED: probable S-adenosylmethionine-dependent methyltransferase At5g37990
Sequence CDS ATGGCGGACTCCTTTGCAATGAATGGTGGCGATGGCCTCAACAGCTACAAGCAGAATTCC AAGTACCAGGGAGAGGGGTTTGATGAAGCAAAGGTCTTGTTGAGAAATAGCATCCGAGAA AAGCTCACAATTCATAAAAATTCCAATGCCACCACTGTCACACCAGGCTTGTTAAGTGAG GCTGCTGTGGACTCGTTCAATCTACCCATTTACGTTCCAAGTGCCAGTGAAGTTGAAGTA GTGATATTGTTGGGTACGAAAAACAAAAACCTTGGTTTTAGTATTGAGAGGTTGGAGGAA ATGCGCTTCCCGGCAAAGCTTTCTAGTGCTGAAGAGGTTCGAGTTTCCTGCCTTCATGCA AGAGCTGCAATGGAAGACATCCTGTGCAAGCATTTCGGATCCGACCTCAATGTTGATGAA CTTTTCAAGAGATATTCGGACAAGCTTGAAGAATTCTCCAAGTCACCTCGGTTTGCTCAC ATTAAGAACTTGGCAAATTTGTTTGTCCTTGTTAAGCGCAATTAG
PEP MADSFAMNGGDGLNSYKQNSKYQGEGFDEAKVLLRNSIREKLTIHKNSNATTVTPGLLSE AAVDSFNLPIYVPSASEVEVVILLGTKNKNLGFSIERLEEMRFPAKLSSAEEVRVSCLHA RAAMEDILCKHFGSDLNVDELFKRYSDKLEEFSKSPRFAHIKNLANLFVLVKRN


| Top |