Cherry SNP DataBase

Gene information

Gene Pav_sc0001183.1_g330.1.mk
Chromosome name PAV_r1.0chr2
start 18157076
end 18167066
PAV_r1.0 name Pav_sc0001183.1
start 144657
end 154647
direction -
Annotation NR PREDICTED: pullulanase 1, chloroplastic
Sequence CDS ATGCCTTTATATACCTCTCCATTTCTTCTTTACCCGTCACCAACTGCTCCAACTGTCAAC TGCCATTTCCCTCGTCGACGCGGCGCCACGTGCCCTTCATCTTCTCTACGGCGCCGTTTC ACCTCCAAAGTGAAACCCTTTCTCCCACTTCCACTCCATTCCGCCAAGGTTTTCAGAAAA CCCAATTTGCAGTGCTCGGCCTCCTCCTTATCCATGTCTGCAGAGGAGTCCGCTTCGACC TCTCAGGGTAGCTTGTTGTATTCAAGGGCATTATGGGTTAGTGAATCAATTATTGCTTGG AATGTGTATGTTGGAAATGGTTCCTGCTATTTATTGGCCAGTAAAACTGCTGCTTTATCT CTTACAAGTGATGGAATTCTAGGTGAGGATGTAAAAGTTAAGCTTGAAGAAGATAAGCAC GGGCTTCCAGAAAATGGTAGCTTCTTGTATTCAAGGGCATTCTGGGTTAGTGAATCAATT ATTGCTTGGAATGTGTATGTTGGAAATGGTTCCTGCTATTTATTGGCCAGTAAAACTGCT GCTTTATCTCTTACAAGTGATGGAATTCTAGGTGAGGATGTAAAAGTTAAGCTTGAAGAA GATAAACACGGGCTTCCAGAAAATGTGAAAGAAAAATTTCCTCATATCAAAGATTACAGA GCTTTTAATGTGCCCCCTGATTTGGACGCCAAACCTCTTCTCAAATGCCAATTGGCTGTT GCTACTTTCAATTCTGATGGAAGGTGCAGTGATGCTACTGGTCTGCAATTACCTGGTATC CTAGATGACTTGTTCTCATATAATGGTCCCCTTGGTGCACTTTATTCAAAACAATCAGTG TCACTTTACCTTTGGGCGCCTACGGCTCAGGAAGTATGTGTTTGCATTTATAGGGATCCA TCAGGTGGGAGTCCCCTAGAAGTAGTGCAACTTGAGGAATTTAATGGCGTTTGGAGTACT AAAGGACCAAAAAGTTGGGAAGGCTGCTATTACGTGTATGAAGTGTCTGTATATCATCCT AGCACCTTGAGAATTGAAAAATGCTATGCAAACGATCCATATGCGAGAGGCAGGCTCTCA TCAGATGGCAGGCGGACATTGTTGGTCAATCTTGATTCTGATAATATAAAACCTGAAGGA TGGGATAATTTGGTAGATGAGAAACCTGATATACTTTCTTTTTCCGACATAAGTATTTAT GAGTTGCACATAAGAGATTTCAGTGCCAGTGACCAGGCTGTGCATCCTGAATTTCGTGGT GGATATCTTGCCTTCACTTTGCAGGCGCTTAACCGTTTTGGCCTTCGCGTTGTCTTGGAC GTTGTTTACAATCACTTGCATGGTAGTGGGCCCGTTGATGATAATTCTGTTCTTGATAAG ATTGTTCCAGGATACTACTTGAGAAGAAATGCAGATGGCTTTATTGAGCATAGTACATGT GTGAACAACACTGCTAGTGAGCATTTTATGGTTGAGCGCTTAATTGTTGATGATCTATTG CACTGGGCAGTTGATTATAAGGTGAGAGTTTACTCGTCAAATGGTGTCTTAAATACCTCA AAGCAGCTTCTCATAGTCACATTTGAAATGAAAACTCTTTTATCCCTGGTTGATGGGTTC CGGTTTGATCTTATGGGTCATATAATGAGAAGAACAATGGTATTTTACTCTAATAAGCCA GTTACATGGTGCAATGAGTGGATGTGCAATAGCCATGGGCCTAAAGATACTAATTTGTGC ACAGAAGCTGTTGCAGAACACATGCTTGCTGAATCAAAGGATCATATTCAGGTTGGCATG GCTGCAAATCTGAGGGACTTTGTTCTAACCAATTGTGAAGGGAAAGAGGTAAAAGGATCA GAAGTATTGACATATGGTGGGACACCTGTAGCATATACTTTATGTCCTACTGAAACTATC AATTATGTTTCAGCTCATGACAATGAAACTCTGTTTGACATAGTGAGTCTGAAGACTCCA ATGGCAATTTCTGTAGAGGAGAGATGCAGGATAAATCATTTGGCGACAAGTATAATAGCA CTAGCACAGGTACTCTTCGCCACTTTTCCGTTTGAGGACGGCAAATGCTATTCAGGAACG GGTACGTCTGCTGTGGAAAATTTCTCAAATTTGTTACGTATTAGGTACTCTTCGCCACTT TTCCGTTTGAGGACAGCAAATGCTATTCAGGAACGGGTACGTTTCCACAATACTGGCCCT TCACTGGTCCCTGGAGTCATAGTAATGAGCATTGAAGATGGTCATGAAGGAGTGCCAGGG TTATCTCAGCTGGATCCAATCTACTCATACATTGTGGTTATCGTCAATGCATGTCCAACT GAGGTGTCATTTGCAAGTCCTTCTCTTCAGGCTCGTACTCTCCAATTGCATCCTGAGCAG GTAATGTCAACTGATGAAATTGTCAAGAGATCTACGTACAACGCTTCCGTAGGATGTTTT ACTGTGCCTCCAAGGACTACGTCCGTGTTCGTTGAGCCTAGGGGAGTTTGA
PEP MPLYTSPFLLYPSPTAPTVNCHFPRRRGATCPSSSLRRRFTSKVKPFLPLPLHSAKVFRK PNLQCSASSLSMSAEESASTSQGSLLYSRALWVSESIIAWNVYVGNGSCYLLASKTAALS LTSDGILGEDVKVKLEEDKHGLPENGSFLYSRAFWVSESIIAWNVYVGNGSCYLLASKTA ALSLTSDGILGEDVKVKLEEDKHGLPENVKEKFPHIKDYRAFNVPPDLDAKPLLKCQLAV ATFNSDGRCSDATGLQLPGILDDLFSYNGPLGALYSKQSVSLYLWAPTAQEVCVCIYRDP SGGSPLEVVQLEEFNGVWSTKGPKSWEGCYYVYEVSVYHPSTLRIEKCYANDPYARGRLS SDGRRTLLVNLDSDNIKPEGWDNLVDEKPDILSFSDISIYELHIRDFSASDQAVHPEFRG GYLAFTLQALNRFGLRVVLDVVYNHLHGSGPVDDNSVLDKIVPGYYLRRNADGFIEHSTC VNNTASEHFMVERLIVDDLLHWAVDYKVRVYSSNGVLNTSKQLLIVTFEMKTLLSLVDGF RFDLMGHIMRRTMVFYSNKPVTWCNEWMCNSHGPKDTNLCTEAVAEHMLAESKDHIQVGM AANLRDFVLTNCEGKEVKGSEVLTYGGTPVAYTLCPTETINYVSAHDNETLFDIVSLKTP MAISVEERCRINHLATSIIALAQVLFATFPFEDGKCYSGTGTSAVENFSNLLRIRYSSPL FRLRTANAIQERVRFHNTGPSLVPGVIVMSIEDGHEGVPGLSQLDPIYSYIVVIVNACPT EVSFASPSLQARTLQLHPEQVMSTDEIVKRSTYNASVGCFTVPPRTTSVFVEPRGV


| Top |