Cherry SNP DataBase

Gene information

Gene Pav_sc0001191.1_g230.1.mk
Chromosome name PAV_r1.0chr1
start 23048212
end 23048484
PAV_r1.0 name Pav_sc0001191.1
start 111094
end 111366
direction -
Annotation NR hypothetical protein LR48_Vigan06g113200
Sequence CDS ATGGAGGACAGTGCCGGTGCTGAGTTTCCAGGCTTCCAAACTTGTGCTCACAAAAATGAC ACCAATATTTTCAGAAGGCATTTGAGTCATCGGCTGCAAAGACGAGCTCCTTGTCCTCTT CAGCTAAACCCTAATAACAATGTCTCTTCAGGTTGCAGCGGTATGCAGAACTCGGTGGGG AGCAGCTCAAATTCTTCTTCTTCATCATTGAATTCCTTCTATCAGAGCAAAGATCCCATT CCCCTACTCTCCCCTCTAGTTTTGCTGCCTTAA
PEP MEDSAGAEFPGFQTCAHKNDTNIFRRHLSHRLQRRAPCPLQLNPNNNVSSGCSGMQNSVG SSSNSSSSSLNSFYQSKDPIPLLSPLVLLP


| Top |