Cherry SNP DataBase

Gene information

Gene Pav_sc0001196.1_g1940.1.mk
Chromosome name PAV_r1.0chr1
start 38667407
end 38679742
PAV_r1.0 name Pav_sc0001196.1
start 1205050
end 1217385
direction -
Annotation NR PREDICTED: squamous cell carcinoma antigen recognized by T-cells 3
Sequence CDS ATGGAAGAAGAAACCCTAAACCCTCAATCAAAGACTCTTACTTCTGAAGATGACAACAAT GGAGACCAACCCATGCCCGACCTCCCTGACCAAGACCCTAGCTCCTCTGATTCCGACTCT GATTCTGGCTCAGAGGACGGAGATCAAGCCCAGAAAAACCTGCAGCTCCAAACCCTAGAA GCCGAGCTCTCCACCAACCCTGGCAACTACGATGCTCATGTCCAATACATAAAGACTCTG AGGCAGATAGCTGACATTGAAAAGCTGAGGCAAGCAAGGGAAGCTATGAATGAGCTGTTT CCGTTAACCCCTTCTATGTGGCAGGATTGGGCTAAGGACGAAGCTTCTCTGTCCACTGGG TCTGATGCTTTTCCTGCTATTGAAAAGCTTTATGAGCGAGGAGTCTTTGAGTATCTGTCC ATCTCTCTTTGGCGTGACTACTTAGATTTTGTTCAAGAAAATGATCCCTCAGTAAGAGAA TGTTCACCTGCTGGTATTTTGAAGGCAAGAGATCTATTTGAACGCGCTCTTACTGCAGCT GGTTTGCATGTTTCTGAAGGCAGTAAACTATGGGAAGCCTACAGGAAATTTGAGCAAGCT ATATTAGATGCTACTGATGAGACTGATAATCAGGCAAGAGACAAGCAGATTCAGCGCATC CGTACTATATTCCACCGTCAGTTGTCAGTTCCCCATGTTAATATGAGGTCAACACTTTTG GATTACAAGGCATGGGAGGTGGAACAAGGGAACATTCTTAATGCTGGCTCAAGTGACCTG GATGGGATTTCATCCCATGTTGCCTCAGCATACAAAAGGGCGTTGGAAATGTATAATGCT CGTGTTCATCTTGAAGAGCAGATTTGTCGTCCGGATATGTCTGACTCAGAAAAACTTCAA AATTTCATGAACTACTTGAAATTTGAACAGTCTTCTGGAGATCCATCCCGGGTTCAGATG TTGTATGAACGCGCTATTACGGAATTTCCTATATCCAGCTATCTCTGGCTTGATTATACC CACTATTTGGATAAAACATTAAAGGTTGGAAGTATTATAACCAACGTGTATTCCAGGGCT GTAAAGAATTGCCCCTGTGTTGGAGAACTTTGGGTCCGATATTTGCTTTCCTTGGAGCGT GGGCATGCTTCTGAGAAAGAGATTGCTGCTGTGTTTGAGAAGTCCCTGCAATGCATTCTA ACCCTTGATGAGTTCCTGGATTTGTACCTCACCCGCATAGATGGCTTAAGAAGAAGAATC TCATGCCCTGTTGAAGGAGAGAGCGTCTTGGATTATTCATTAATAAGGGAAACCTTTCAG AATGCATCAGACTACTTTTCACAATACCTGAAGAACACGGATGGTTTGTTACGTTTGCAT GCTTATTGGGCCCGTCTAGAGCTAAATCTGCATAAGGACTTACAGGCAGCTCGTGGAGTG TGGGAAAGTTTACTTAAGATATGTGGTTCAATGCTGGAAGCCTGGCAAGGTTATATAACA ATGGAAGCTGAATTGGGCCATGTGAGTGAAGCTCGGTCTCTATATAGGAGATGCTACAGT AAAAGATTTCCAGGAACTGGTTCAGAGTTTGAGTATGATACACTCTGTTCCTCTTCCATA ATCCTATTCAATTATTTAGCAGAGAAATCAAATATAATATCTTGA
PEP MEEETLNPQSKTLTSEDDNNGDQPMPDLPDQDPSSSDSDSDSGSEDGDQAQKNLQLQTLE AELSTNPGNYDAHVQYIKTLRQIADIEKLRQAREAMNELFPLTPSMWQDWAKDEASLSTG SDAFPAIEKLYERGVFEYLSISLWRDYLDFVQENDPSVRECSPAGILKARDLFERALTAA GLHVSEGSKLWEAYRKFEQAILDATDETDNQARDKQIQRIRTIFHRQLSVPHVNMRSTLL DYKAWEVEQGNILNAGSSDLDGISSHVASAYKRALEMYNARVHLEEQICRPDMSDSEKLQ NFMNYLKFEQSSGDPSRVQMLYERAITEFPISSYLWLDYTHYLDKTLKVGSIITNVYSRA VKNCPCVGELWVRYLLSLERGHASEKEIAAVFEKSLQCILTLDEFLDLYLTRIDGLRRRI SCPVEGESVLDYSLIRETFQNASDYFSQYLKNTDGLLRLHAYWARLELNLHKDLQAARGV WESLLKICGSMLEAWQGYITMEAELGHVSEARSLYRRCYSKRFPGTGSEFEYDTLCSSSI ILFNYLAEKSNIIS


| Top |