Cherry SNP DataBase

Gene information

Gene Pav_sc0001196.1_g390.1.mk
Chromosome name PAV_r1.0chr1
start 39625910
end 39637915
PAV_r1.0 name Pav_sc0001196.1
start 246877
end 258882
direction +
Annotation NR PREDICTED: DDB1- and CUL4-associated factor 13-like isoform X1
Sequence CDS ATGAAGGTGAATGTAATATCTCGGTCCACAGATGAATACACTAAAGAACGAAGCCAAGAC CTCCAGAGGGTATTCCGTAATTTCGACCCCAGCATCCGAACGCAAGAGAAAGCAGTGGAA TATGTCCGGGCATGTAATGCCGCAAAATTAGAGAAGGCATGTTTTGGGATTTGGATTATT TTTGCGAGGCCATTTGTTGGAGCAATGGATGGACATATAGATTCAATTTCCTGTATGGCA AAGAATCCAAACCATTTGACCAGAATATTTTCTGGTTCAATGGATGGAGATATTCGGCTC TGGGATATAGCTTCCAGGCGAACAGTTTGTCAATTTCCTGGTCACCAAGGTGCTGTGCAA GGTTTAGCAGTATCTACAGATGGGCGTGTTCTTGTTTCTTGCGGAACTGACAGCACTGTC AGGCTTTGGGGTGTACCTGTTTCTACTCTTCTGGAGGATGATGTCTCATCTGATAAATCT GCTGTGCCACTGGAAACTTATGTTTGGAAGAATGCATTTCGGGCTGTTGATCACCAGTGG AATTTTGATCGTTTTGCTACAGGTGGAGCTGGAGTAGATATATGGAACCACAACAGTGAT CGCAGCATAGCAATATATGACTTGCGCATGGGGAAACCAGCAGCGAAGTTTATTATGAGG ACAAGAACCAATTCCATTTCTTGGAATCCAATGGAGCCAATCAACTTCACTGCTAGGGTA TTCCGTAATTTCGACCCCAACATCCGAACGCAAGAGAAAGCAGTGGAGTATGTCCGGGCA TGTAACGCCGCAAAATTAGAGAAGGCATATTTTTGCGAGGCCATTTGTTGGAGCAATGGA TGGACATATAGATTCTATTTCCTGTATGGCAAAGAATCCAAACCATTTGACATGAATATT TTCTGGTTCAATGGATGGAGGCGAACAGTTTGTCAATTTCCTGGTCACCAAGGTGCTGTG CAAGGTTTAGCAGTATCTACAGATGGGCGTGTTCTTGTTTCTTGCGGAACTGACAGCACT GTCAGGCTTTGGGGTGTACCTGTTTCTACTCTTCTGGAGGAAGATGTCTCATCTGATAAA TCTGCTGTGCCACTGGAAACTTATGTTTGGAAGAATGCATTTCGGGCTGTTGATCACCAG TGGAATTTTGATCGTTTTGCTACAGGTGGAGCTGGAGTAGATATATGGAACCACAACAGT GATCGCAGCATAGCAATATATGACTTGCGCATGGGGAAACCAGCAGCGAAGTTTATTATG AGGACAAGAACCAATTCCATTTCTTGGAATCCAATGGAGCCAATCAACTTCACTGCTGCA AATGAGGACTCCAATTGCTATAGCTTTGATTCTAGAAAGCTTAATGAAGCTAAGTGTGTG CACAAGGATCATGTATCTGCTGTGATGGATATTGATTATTCTCCAACTGGTCGAGAATTT GTCACTGGATCTTATGACAGAACAGTGAGAATTTTCCAGTATAATGGTGGTCACAGCCGG GAAATTTATCATACAAAGAGAATGCAAAGGGTGTTTTGTGTCAAGTTCAGCTGTGATGCT AGTTATGTTATTTCTGGGAGTGATGACACTAATCTTAGGCTTTGGAAGGCTAAAGCATCA GAACAATTGGGAGTTCTTCTTCCAAGGGAACAGAAAAAGCATGAGTATAATGAGGCTGTC AAGAATCGCTACAAGCACCTTCCGGAAGTCAAGCGTATTGTGAGGCATAGGCACCTACCA AAACCAGTATACAAGGCAGCTGCAACATTGCGTGAGATGACCGAATCTCGGAGAAAGAAA CATGAGAAGAGGAAGGCGCATAGCGCCCCTGGAAGCATCATTGAAGAGCCATTACGGAAA AGAAAAATCATCAAAGTTGAGTGA
PEP MKVNVISRSTDEYTKERSQDLQRVFRNFDPSIRTQEKAVEYVRACNAAKLEKACFGIWII FARPFVGAMDGHIDSISCMAKNPNHLTRIFSGSMDGDIRLWDIASRRTVCQFPGHQGAVQ GLAVSTDGRVLVSCGTDSTVRLWGVPVSTLLEDDVSSDKSAVPLETYVWKNAFRAVDHQW NFDRFATGGAGVDIWNHNSDRSIAIYDLRMGKPAAKFIMRTRTNSISWNPMEPINFTARV FRNFDPNIRTQEKAVEYVRACNAAKLEKAYFCEAICWSNGWTYRFYFLYGKESKPFDMNI FWFNGWRRTVCQFPGHQGAVQGLAVSTDGRVLVSCGTDSTVRLWGVPVSTLLEEDVSSDK SAVPLETYVWKNAFRAVDHQWNFDRFATGGAGVDIWNHNSDRSIAIYDLRMGKPAAKFIM RTRTNSISWNPMEPINFTAANEDSNCYSFDSRKLNEAKCVHKDHVSAVMDIDYSPTGREF VTGSYDRTVRIFQYNGGHSREIYHTKRMQRVFCVKFSCDASYVISGSDDTNLRLWKAKAS EQLGVLLPREQKKHEYNEAVKNRYKHLPEVKRIVRHRHLPKPVYKAAATLREMTESRRKK HEKRKAHSAPGSIIEEPLRKRKIIKVE


| Top |