Cherry SNP DataBase

Gene information

Gene Pav_sc0001196.1_g400.1.mk
Chromosome name PAV_r1.0chr1
start 39619044
end 39624350
PAV_r1.0 name Pav_sc0001196.1
start 260442
end 265748
direction +
Annotation NR PREDICTED: alanine--glyoxylate aminotransferase 2 homolog 1, mitochondrial-like
Sequence CDS ATGGCATTGCAGAGGCAGCTCTTGAAGAAAGCTCTAGGGGAAGCCAAGACCAAGATTGGT GGCTCCCGTTTTTGTCAACGGCCATCTCTCTGCGGTTCTTTCTCTACGGTTCCTTCTTCT GCTGCTGATCATGAGGCTGCTCTGCCTTTGCTGCCGCCGTTTGATTACGAGCCAAAGCCT TACAATGGACCTCGGGGCGATGAGGTCTTCCAGAAGCGAAAGAAGTTTCTGGGTCCTTCT CTTTTCCATTATTATCAGAACCCTCTCAATATTGTTGAAGGGAAGATGCAATATTTGTTC GATGAGAATGGCAGGGGCTACCTTGATGCTTTTGCTGGGATAGTCACTGTTTCTTGTGGC CATTGCCATCCAGAAGTTTTAAATGCTATCATGGAGCAGAGCAAGCTTCTGCAGCATGCC ACAACCATTTACCTGCACCATGCAATAGCTGATTTTGCCGAGGCATTAGCTTCAAAAATG CCTGGAAATTTAAAGGTTGTTTACTTTGTGAATTCTGGGACAGAAGCAAATGAATTAGCA ATGTTGATGGCTCGTCTATATAGTGGCAGTCTTGATATGATTTCGTTGAGAAATGCATAT CATGGGGGAAGTTCTAATACAATTGGTTTGACCGCTTTGAACACATGGAAGTATCCAATT CCACAGGGTGAAATTCATCACGTTGTAAATCCAGATCCATACCATGGAATCTTTGGCTCG GATGCCAAAAGTTATGCTAAAGATGTACAAGATCACATTGATTATGGAACTTCAGGAAAA GTTGCTGGATTTATATCTGAAACAATTCAGGGAGTTGGAGGAGCAGTTGAATTGGCACCT GGATATTTAAAACTGGTTTATGACATTGTTCGCAAGGCTGGTGGTGTCTGCATTGCTGAT GAAGTACAAACTGGGTTTGGGCGCACAGGAAGCCATTATTGGGGCTTTGAAACGCAGGGT GTCATTCCTGATATAGTTACCATGGCTAAGGTCTTTAAATATCAATTGATAGTTTTGCTC AGAGTTATTGATAAGGAGAAGTGTCAAGTTCATTGCGCTGATGTTGGCTCTCACTTGCTT GGGCGTTTGAGAGATCTTCAGCAAAGATATGAAATCATTGGAGATGTCAGAGGCCAAGGC TTAATGGTGGGGATAGAGCTTGTCACTGACAGGAAAGAGAAGACGCCTGCGAAGGCAGAA ACCACAGTTTTGTTCGAGAAACTCAGAGATTTTCTTGTTGATGCTTTGGACTACTCCATG TCAAAGTTGTGA
PEP MALQRQLLKKALGEAKTKIGGSRFCQRPSLCGSFSTVPSSAADHEAALPLLPPFDYEPKP YNGPRGDEVFQKRKKFLGPSLFHYYQNPLNIVEGKMQYLFDENGRGYLDAFAGIVTVSCG HCHPEVLNAIMEQSKLLQHATTIYLHHAIADFAEALASKMPGNLKVVYFVNSGTEANELA MLMARLYSGSLDMISLRNAYHGGSSNTIGLTALNTWKYPIPQGEIHHVVNPDPYHGIFGS DAKSYAKDVQDHIDYGTSGKVAGFISETIQGVGGAVELAPGYLKLVYDIVRKAGGVCIAD EVQTGFGRTGSHYWGFETQGVIPDIVTMAKVFKYQLIVLLRVIDKEKCQVHCADVGSHLL GRLRDLQQRYEIIGDVRGQGLMVGIELVTDRKEKTPAKAETTVLFEKLRDFLVDALDYSM SKL


| Top |