Cherry SNP DataBase

Gene information

Gene Pav_sc0001196.1_g700.1.mk
Chromosome name PAV_r1.0chr1
start 39438693
end 39443859
PAV_r1.0 name Pav_sc0001196.1
start 440933
end 446099
direction -
Annotation NR PREDICTED: uncharacterized zinc finger protein At4g06634 isoform X1
Sequence CDS ATGTTGCAGAAATTTTTGGATAGTTCAAAGTTGAAAAGACACTTTCTTATTCATACTGGA GAGAGAGATTTTCGGTGTACTTATGACGGCTGTGGTAAGGCCTTCTCCCTGGATTTCAAC CTTAGGTCTCACATGAAAACACATTCGCAAGAGAACTATCATATTTGTCCATACCCAGAC TGTGGAAAGAGATATGCGCATGAATACAAGCTTAAAAACCACATTTCGGCTCACCATGAG AAGAGTGCGATGGTGGACGTGCCAAAATATGCTACCCCACCTGCAGAGAAGCAAATCAAA ACTCCCAAGCCTCCTGCAGGGGTTTATGGCTCTGCATCATCTGATCGCCCTTATGCTTGT CCTTATGAAGGGTGTGAAAAGGCCTACATCCATGAATACAAGCTTAAACTACATCTCAGG AGAGAGCATCCTGGCCATATGTCCGATGAGAATGCGGAGAATGCACCTAATAATGCTGAC AATGAGATGGATGAAGCCAGTGATCAAGATGCCTATGCTGGAAAACGTGTGAATGGCAAG AGCCAGAAACAAAACAGGCCCAAACCAAACTTAAAGTTCCCGCCTGCAAAAGTTGTTCAG CGTAAAGGCTCAACTCCATCTCCTGCCACTATGAACACAATGAAAAAACCCTGGCCCGTC AAGGATGAAGTAGTTTACGAGGAAGAAGATAGTGAAGAGACAGAGGAGGACCGCGACAAT GTTGAGGATGGTTGGAGGTACGGTGAAAACAATGATGACGATGATGAAGAAACAGAGGAC GAAGACTAG
PEP MLQKFLDSSKLKRHFLIHTGERDFRCTYDGCGKAFSLDFNLRSHMKTHSQENYHICPYPD CGKRYAHEYKLKNHISAHHEKSAMVDVPKYATPPAEKQIKTPKPPAGVYGSASSDRPYAC PYEGCEKAYIHEYKLKLHLRREHPGHMSDENAENAPNNADNEMDEASDQDAYAGKRVNGK SQKQNRPKPNLKFPPAKVVQRKGSTPSPATMNTMKKPWPVKDEVVYEEEDSEETEEDRDN VEDGWRYGENNDDDDEETEDED


| Top |