Cherry SNP DataBase

Gene information

Gene Pav_sc0001196.1_g960.1.mk
Chromosome name PAV_r1.0chr1
start 39251919
end 39258848
PAV_r1.0 name Pav_sc0001196.1
start 625944
end 632873
direction -
Annotation NR PREDICTED: uncharacterized protein LOC103319019 isoform X1
Sequence CDS ATGGCTGGCGAAAAGAAAATTGAGAAAGGAGAGCCTATATCCACTGTACTGACGGCAGAT TCTGTTACTGGATTGAGTCAGCAAGAAGTGGTATCTGGAAAAGACGGAATACCATCTGAT TCAATCCCCTCCATGTCTTCTCTATTGGATTCCACCTCTAGCATCAAAGGTGAGACTGAT CAAGATTCAGTTGGAGAGCATGGTGTTTACTATCAACCTACTAGCTGTTACAATTATTAT TACCCAGGCTATAATGGATCGTTTACACAGATGGATGATCATGGTTATTTACACGCTAAT AATCAGCATACGGGTGTGCAGTCAGACAATGGTTCAATGGTCTATTATCTTCCGGGTTAT AACCCATATGCCCCGGGAACTCTTATGGGAATTGACAGCCAAGGTGTTGGTCAACAGCAG TATTTTCCTTCCTCAGGGTATATGCAACCTCCTGTTTCCTATGGTTCAGAAGCTGCGCCT TGTTATTCATGGGATACAACATTTGTTGGTGACGTCTCTACTGCAGCGAATTCTGGTTTT GGAAATGTAAAGGTCGGTCCAGGTTCTGCTGCTTTGTCTAAGTCGGGTGGCTTTATCTCG ACTAAAACCAATGGCAATCTTCCTAGCAGATTTTCCAAGTCTCTCCCTCATACACAACCC TTGAAATCATTAAACAAGGTACCTCATTTGGGCAATGATTTCTCAGCGGGTCTTTTGAAG GGGTACAACCCAGCTGGAAGGTTCTCATCATTTGCTAACCAGAAGTATGGTCTTTTTCCT CCAAATGGTCACCTGAACTACAAATCTAATGCGAGAATTTTGAATGGAAATGATAGATTT AAGTCCAGGGAAAACTATAACAGGAATGAAGATTTTGAATCCTCAACTGAGCTGACACGT GGTCCAAGGTCCCGAAACAAGAGTCCTCCTTTAGATTCAGCAATTGAGAAGGACGAACTA TCGTTTACAGTCCATAGAGATCAATATAATCTACCAGATTTTCATACTGGTTATGAAAAA GCGAAGTTTTATGTCATCAAGTCTTACAGTGAGGATGACGTCCATAAGTCCATTAAATAT GATGTTTGGGCCAGCACTCCAAACGGCAATAAAAAACTAGATGCGTCATTTCGTGATGCT GAATCAAAATCGAGGGAGACAGGCACCCAGTGCCCCATCTTCCTCTTCTTCTCGGTAAAT GGAAGTGGACAGTTTATTGGCCTAGCTGAGATGGCTGGCCAGGTGGATTTCAATAAAGAT ATGGATTTCTGGCAAGTTGACAAGTGGAGTGGTTTCTTCCCAGTAAAATGGCATGTAATA AAGGACATACCTAACACTCAATTGCGGCATATTATCCTTGAAAATAATGATAACAGACCT GTAACTTTTACCCGGGACACTCAAGAGATTGGACTGAAGCAAGGTTTGGAAATGCTGAAC ATATTTAAAAGCTACACAGCTAAAACATCATTGTTAGATGATTTTAATTTCTATGAGGAT CGAGAAAAGTCTCTGAAAGCCAAGAGGAGCAGTAAGCCTGCAACTTTGAAGATGGAAACT TATGACAATAATGATATTAATAAACATATAAATGCAGGAGGGAGAAACGTTGATGATGAA TCAGCTGGAATAAGGATGGCTTCCGATCGAGCATCTCTCATTTCACTCACCAAAAATCTA TCCCTCAATGGTTGCCCATGA
PEP MAGEKKIEKGEPISTVLTADSVTGLSQQEVVSGKDGIPSDSIPSMSSLLDSTSSIKGETD QDSVGEHGVYYQPTSCYNYYYPGYNGSFTQMDDHGYLHANNQHTGVQSDNGSMVYYLPGY NPYAPGTLMGIDSQGVGQQQYFPSSGYMQPPVSYGSEAAPCYSWDTTFVGDVSTAANSGF GNVKVGPGSAALSKSGGFISTKTNGNLPSRFSKSLPHTQPLKSLNKVPHLGNDFSAGLLK GYNPAGRFSSFANQKYGLFPPNGHLNYKSNARILNGNDRFKSRENYNRNEDFESSTELTR GPRSRNKSPPLDSAIEKDELSFTVHRDQYNLPDFHTGYEKAKFYVIKSYSEDDVHKSIKY DVWASTPNGNKKLDASFRDAESKSRETGTQCPIFLFFSVNGSGQFIGLAEMAGQVDFNKD MDFWQVDKWSGFFPVKWHVIKDIPNTQLRHIILENNDNRPVTFTRDTQEIGLKQGLEMLN IFKSYTAKTSLLDDFNFYEDREKSLKAKRSSKPATLKMETYDNNDINKHINAGGRNVDDE SAGIRMASDRASLISLTKNLSLNGCP


| Top |