Cherry SNP DataBase

Gene information

Gene Pav_sc0001203.1_g140.1.mk
Chromosome name PAV_r1.0chr2
start 31987
end 37691
PAV_r1.0 name Pav_sc0001203.1
start 81916
end 87620
direction +
Annotation NR PREDICTED: cycloartenol-C-24-methyltransferase
Sequence CDS ATGCCACTAACCTCCCCCGAAAAGTCTCGACTTTATCTCGGGTTCTCTCGGATTCTTCTT TTGATATCTCCGCAACTCTGTTTTTGGGAAATTCAAGAGGAGATGTCGAAAGCTGGAGCA TTGGATCTCGCATCGGGTCTTGGTGGAAAGATTGACAAAACCGAAGTTCTCTCTGCTGTT GAAAAGTATGAGAAGTATCATGTCTGTTATGGAGGCGAAGAGGAAGCAAGAAAATCTAAC TATACTGACATGGTTAATAAATATTATGATCTTGTTACCAGCTTTTATGAGTATGGCTGG GGAGAGTCTTTCCACTTTGCACCCAGATGGAAAGGGGAGTCTCTTCGAGAGAGTATCAAG CGACATGAGCACTTCCTTGCTTTACAACTAGGACTAAAACCTGGACAGAAAGTTCTGGAT GTAGGTTGTGGAATTGGAGGACCATTGAGAGAAATAGCTCGCTTCAGCTTAGCATCAATT ACTGGGTTGAACAACAATGAATATCAGATCACAAGAGGAAAGGAACTAAACCGTACCATA GGAGTGGACAAGACTTGCAATTTTGTAAAGTATGGATGCTACAAGGAGATTTACAGAGTA TTAAAACCCGGTCAATGTTTTGCTGCATATGAGTGGTGCATGACTGATGCATTCGATCCC AATAACCAAGAACATCAAAAAATTAAGGCGGAAATTGAGATTGGTGATGGCCTCCCAGAC ATCAGATTGACAGGAAAGTGTCTTGAAGCTTTGAAACAAGCTGGTTTTGAGGTGATATGG GAGAATGATCTTGCAGTGGACTCACCTCAACCTTGGTACTTGCCTTTGGACACAAGTCGG ATTTCATTTAGTAGCTTTCGTCTAACAGCTGTTGGGCGTTTTTTTACTAAAAACATGGTC AAGGCTTTAGAATTTGTTGGACTTGCACCACCAGGAAGCCAAAGGGTTCAAGATTTTCTG GAGAAAGCAGCTGAAGGGCTAGTAGAAGGTGGAAAGAGAGAGATTTTCACACCGATGTAT TTCTTCTTGGCCCGGAAGCCGCTTTCAGAGAGTCAGTAA
PEP MPLTSPEKSRLYLGFSRILLLISPQLCFWEIQEEMSKAGALDLASGLGGKIDKTEVLSAV EKYEKYHVCYGGEEEARKSNYTDMVNKYYDLVTSFYEYGWGESFHFAPRWKGESLRESIK RHEHFLALQLGLKPGQKVLDVGCGIGGPLREIARFSLASITGLNNNEYQITRGKELNRTI GVDKTCNFVKYGCYKEIYRVLKPGQCFAAYEWCMTDAFDPNNQEHQKIKAEIEIGDGLPD IRLTGKCLEALKQAGFEVIWENDLAVDSPQPWYLPLDTSRISFSSFRLTAVGRFFTKNMV KALEFVGLAPPGSQRVQDFLEKAAEGLVEGGKREIFTPMYFFLARKPLSESQ


| Top |