Cherry SNP DataBase

Gene information

Gene Pav_sc0001224.1_g090.1.mk
Chromosome name PAV_r1.0chr6
start 14295459
end 14304757
PAV_r1.0 name Pav_sc0001224.1
start 35378
end 44676
direction -
Annotation NR PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503
Sequence CDS ATGGCAGTCTCTTTCACTCGTTTTTCATGGTGTTGGTGGGGTGGGAAAGAGAAAGAGCCT GCTAATAATGGGTCTTCTCTAAATTCTTCTTTTGAGTGCGGTTTTGGTGGTCTGAGGGAA CCTGGAACTGTCCAATTCCCTTCAGTTAAGGGCACGAAAATGGCCTCGTCTCCCAGAAAG GTTAAGAGGAAGTGGCAGAGTAGAGAAGAGAGGAGGATTGATAGGGAGTATGATGTTGTT ATTGTGCCATCGGATGGTGGAGGCTGTTTGTCAGGGTCTGAATCCGATGACTCGGACTGG TCCATAGGGTGGTTGGAGCCTCATGGCCCTGGTTTCCAGAGTGATGATGAATCGGATAAT AGTTTTGCAGTGCTGGTCCCTTGCTACAGCCCTGGTTGCAAGGAGGTGGTGGAGGGTTCT AATAATGAGCTTTTGAGTGCCATCAAGAACCTCCCAGATGAGTTCTCTTCTGATATGGAG GAAAAGGTGCAATATGTGCTTAAACTCATTGAAGAGGATGGAGACTCTTTTGCCAAGAGA GCAGAAATGTACTACAAAAAGAGACCAGAGCTGATACACTTTGTTGAAGAAACCTACAGA GCGTACCGGTCCTTGGCTGAACGGTATGATCACATTTCAACAGAGCTACAAAATGCCAAC AACACAATTGCTTCTGTTTTCCCAGAACAAGTTCAGTTTGCCATGGATGAAGAAGATGAT TATCCCTCACCCAGAATGCCAAAAAGGCCTCCAGATATCTCAAAAGGGAATATCCCAAAG GTTCCAAAGGGTCCTACTAAAGATCTAAAGAGTCTTCTTACAAAAGCAACAGCTAAAAAT AAACTGCAGCCTCAGAGCTCAATGAAAGCAGTAACTGCTAAAGCAGTTCCTAAATCTGAC TTGAGCAAACCTCAGGCACTTGAAGAGATTGACAAGGCTCAAAAACAAATTCTGTCCCTA CAAACTGAGAAAGAGTTTGTAAAGAGCTCATATGAAAATGGACTTGCAAAGTACTGGGAA ATAGAGAACCAAATCAAGGGAATGCAAGAGAAAGTATCCAATTTGCAAGATGAATTTGGT GAGGGAATGGTCATTGACGATAATGAGGCTCGGAATTTGATGGCAGCATCTGCTTTAAAT TCATGCCAAGAGACATTGGCTCAATTGCAGATGAAACAGGAAAGTACAGCTGAGGAAGCA AGAATTGAGTCACAACGGGTTAAGGATGCCATGAAGAACTTAGAGTCTCTTAAGAATGAG TTTCATCATGGTCAAATCAATCAGGAAATGCCAAATGCACAGGATGAATCTGTGAATGTA GTAAATGAGAAAAAATTGGACCAGGAAGCGGACAGTGTGACACAACAGAAACAGAAATTG GAGTTGTTACGAGATAAAATTAAGGAACACTACGAGGCTGGGCCTGAAACATCTCTCACT ATTACGGAAATGGCAGATAAGATTGATGAGCTTGTGAATAAAGTGATCAGCTTAGAGAGT GCAGTTTCATCACAGACTGCTCTAGTCCAGAGATTAAGAAGTGAAAATGACGAGATTCAT GAACAAATTCGAATTCTGGAAGATGATAAGGTAAGTCTCATTGATGGCAAGAAGGACTTG AGCAAAAAGCTGAAGGAACTGGAGGAAAAGTTGCATAAAGTCCAGGATCTAAACCAAAGT GTTGAAAACCAGAATGACAATCTCCAGACACATTTTACTGAAGCACATTGTAATCTTGGT CACATTTCTCATAAACTGCGAACCGTGAAGCCAGATGAGGAGGTCAAGGTCACAGGCTCA TCAGAAACGAAAGAGGGATCTCTTGGGGAAGCCAAGTTGCAAAAGCAGTTTGAAGGAGAA GAAAAAACAGTTAATCCTGATGATGGCTTCAAGGGACTGCAGGAAGCAAAGTCAGGAGAG GAACTGAAGGCTACAGTTTCACCGCAAAAAGATGAAGAGCCTCGGGCTGAGGTGAGACCA TCAAAAAATTCCACAGAACATAAAGAAATACCAAATCCTGCTGATGGTTCTGTAAAAGCT ACAGATGTTCTCCGTACTGCTGGCGATCAAGGAGAAGATGTTTGTCAATCCCTGGAAATT AATAACGAAGATAAGAAACATCTGGACAAAGATGACAAGCAAACTTCAGTGCAGCCTGTG GATAATCTTCTCAATATGGAACCAAAGGAACAAGCAACAAGGAAAGAAGATGACAAGCAA ACTTCAGCGCAGACTGTGGATAATCTTCTCAATAAGGAACCAAAGGAACAGTCAACAGGG AAAGAAGATGACAAGCAAACTTCTGCTCAGACTGTGGATAATCTTCTTAATAAGGAACCA AAGGAACAGTCAACAGGGAAAGAAGATGACAAGCAAACTTCTGCTCAGACTGTGGATAAT CTTCTCAATATGGAACCAAAGGAACAAGCAACAATGAAAGAAGATGACAAGAAAACTTCT GCTCAGACTGTGGATAATCTTCTCAATATGGAACAAAAGGAACAAGCAACAGGGAAAGAA GATGACAAGCAAACTTCAGCGCAGACTGTGGATAACCTTCTCAATATGGAACCGAAGGAA GAAGAACCAGACTGGCAGAAATTGTTTTTGAATGGGATGGAGGACAGAGAGAAGATTCTA TTGGCAGAGTACACTACAACTCTTCGGAACTACAAGGATCTCAAGAAGAAGTTCAGTGAA GTTGAGAACGACCTCTTTGAAACATCCGTCCACATAAAAGAACTGAGGAGTTCCAGTGCC ATGAAGGATGAAGAGATTAAATCATTGCATAAGAAGCTGGATCTTCTGCTACAGAGTATA GGTAAAAATAAAGACTCAGAAGAATTTAAAGCTTTAGATCACCAGCAGACCCCAACGAGT ACACCAGCAGATAAGAAAGACTATGATGAACTTGAGGGAACTTCAACTATATCAGCAATC GAAGAAAAATTCCGGGGCAATATTGATGAACTGTTGGAAGAGAACTTGGATTTCTGGTTA AAATTTAGCGCTTCATTTACACAGGTACAACAATTTGAAACTACGGTAGAAGATTTGCAG TCTGAGATATCCAAGCTTGAGGAGAGAAGAAAGAAACAAGATGGAAGTAGTAATGCAAAA TATTCTATGAAATCAGATGCACGACCGCTATACAAGCACCTAATGGAGATACAGACTGAA CTAAATGTTTGGTTGGAAAAGGGTGCATTACTGAAAGATGAGCTGCAGTGCAGATTCACG TCTTTATGCAACATTCAAGAAGAAATAACAAAAGCTTTGAAGACAGGTGCTGAGGATGGC GACTTCAAGTTTACAAGCTACCAAGCTGCAAAGTTCCAAGGCGAGATTTTAAATATGAAA CAAGAGAATAACAAGGTTGCAGATGAATTGCAAGCAGGATTGGACCATGTGAACGCACTC CAACTTGAAGTAGAAAAAACTATGGCAAAGTTGAACGAGGAGTACAGGCTCTCTGGATCA AAGAAGCAACCTCCTGCACATCTAGCTCACTCTGAGAGTCGGTCCCGAGTTCCCTTGCGG TCATTTATATTTGGTGTTACACCAAAGAAGCAAAAGCGATCAATCTTCGCCGTAGTGGCC CCTGCAATGCATAAGAGATACCAAGATTCGAAAGCTAGATCATCCCAGCAGTAA
PEP MAVSFTRFSWCWWGGKEKEPANNGSSLNSSFECGFGGLREPGTVQFPSVKGTKMASSPRK VKRKWQSREERRIDREYDVVIVPSDGGGCLSGSESDDSDWSIGWLEPHGPGFQSDDESDN SFAVLVPCYSPGCKEVVEGSNNELLSAIKNLPDEFSSDMEEKVQYVLKLIEEDGDSFAKR AEMYYKKRPELIHFVEETYRAYRSLAERYDHISTELQNANNTIASVFPEQVQFAMDEEDD YPSPRMPKRPPDISKGNIPKVPKGPTKDLKSLLTKATAKNKLQPQSSMKAVTAKAVPKSD LSKPQALEEIDKAQKQILSLQTEKEFVKSSYENGLAKYWEIENQIKGMQEKVSNLQDEFG EGMVIDDNEARNLMAASALNSCQETLAQLQMKQESTAEEARIESQRVKDAMKNLESLKNE FHHGQINQEMPNAQDESVNVVNEKKLDQEADSVTQQKQKLELLRDKIKEHYEAGPETSLT ITEMADKIDELVNKVISLESAVSSQTALVQRLRSENDEIHEQIRILEDDKVSLIDGKKDL SKKLKELEEKLHKVQDLNQSVENQNDNLQTHFTEAHCNLGHISHKLRTVKPDEEVKVTGS SETKEGSLGEAKLQKQFEGEEKTVNPDDGFKGLQEAKSGEELKATVSPQKDEEPRAEVRP SKNSTEHKEIPNPADGSVKATDVLRTAGDQGEDVCQSLEINNEDKKHLDKDDKQTSVQPV DNLLNMEPKEQATRKEDDKQTSAQTVDNLLNKEPKEQSTGKEDDKQTSAQTVDNLLNKEP KEQSTGKEDDKQTSAQTVDNLLNMEPKEQATMKEDDKKTSAQTVDNLLNMEQKEQATGKE DDKQTSAQTVDNLLNMEPKEEEPDWQKLFLNGMEDREKILLAEYTTTLRNYKDLKKKFSE VENDLFETSVHIKELRSSSAMKDEEIKSLHKKLDLLLQSIGKNKDSEEFKALDHQQTPTS TPADKKDYDELEGTSTISAIEEKFRGNIDELLEENLDFWLKFSASFTQVQQFETTVEDLQ SEISKLEERRKKQDGSSNAKYSMKSDARPLYKHLMEIQTELNVWLEKGALLKDELQCRFT SLCNIQEEITKALKTGAEDGDFKFTSYQAAKFQGEILNMKQENNKVADELQAGLDHVNAL QLEVEKTMAKLNEEYRLSGSKKQPPAHLAHSESRSRVPLRSFIFGVTPKKQKRSIFAVVA PAMHKRYQDSKARSSQQ


| Top |