Cherry SNP DataBase

Gene information

Gene Pav_sc0001236.1_g130.1.mk
Chromosome name PAV_r1.0chr6
start 21343568
end 21353446
PAV_r1.0 name Pav_sc0001236.1
start 36460
end 46338
direction +
Annotation NR PREDICTED: probable Xaa-Pro aminopeptidase 3
Sequence CDS ATGGCGTCGTCTGAGAACGTAGCGAGCATGATGGAGCCTTGGGCCTTCAGGACCAACACG TTCGCCGACTCGTGGATCTCCGAGACCTTCTCGCGCGACACCAAAACCCTCACCAGGGCC CTCCAGAAGTCTCTCTCCAACAACCCAGAATCGCTAGATTCTTCCTCTGATATGTTCATG CCGTTTCTTAACAACATCCTCCAACCCGAAACGGCACCCACCCCTACTGTTTCGGGGCTG TCCGGCTCGGAGGATCCCGATACGAGCCCAGCACCGCCGAAACGCCAGCAGCGAAACGCG ATTCCGGTGTCCGGTGCTGGTGGCGGCAAGGTTTCGAAACGCAAGTCTCGCGCGGCGAAA CGGTCCCAGACGACTTTCATCACGGCGGACCCGAGCAACTTCCGCCAGATGGTGCAACAG GTGACCGGCGTTAGATTCGGTAACGAGCAAGTCCCCTTGCCGTCGATTCTGAAGCCGGAA CCTCAGAGACTAGGTAGCCGGTTACCCGGGATTGGCTGCTGCATGCCGACCCTTGATACG TCGGCGTTTCTCCTAGAGCATCACAATCAGCAGCAGCAGCAGCTGGTAGGGCCCACGACG ATGACGGGGGCTGGGCTCAACACGACATTGACTGGGCTTGGGCCAGCGTCGTTTGGGCAG ACGAGTATTGGTGAGGACGTGGCATCGGCAGGTGGCGTTGCGTCTGGGGGATTAGGTTTT GACTCTTTCTCGAGCTTTCCCACTTTAGAGTCCTGGAAGGCAATTGGACGCCGTGCATAT TCTACAAAGAAGATAGTTGATATTGGACAGCCATCTCCGGCGTCACATCCCCAGTTACTG AAAGAAGGGGAAATTACACCCGGCATAACTTCAGAGGAGTACACATTGAGAAGAAATAAG TTGTTGGAGGTGCTCCCAGAGAAGGGTTTGGCCATTTTTGCAGCTGCCCCTGTAAAGATG ATGACTGATGTCGTGCCTTACACATATCGTCAAGATGCTGATTACTTGTATATTACCGGC TGCCAACAACCTGGTGGCGTGGCAGTTTTAGGTCATGAATGTGGTTTTTGCATGTTCATG CCAGAAGCGACATCTCATGATGTTATTTGGCAAGGGCAAATTGCGGGAGTTAGTGCAGCA CTGGAAGTATTCAAGGCTGATAGAGCATATCCAATGAGCAAATTACGGCAGATCCTGCCA GATATTATGAAGGGATCGTCCGAGTTGTTCCACAATGTGCAGACGGCTGTACCAACATAT ATGGAATTGGATGCTTTTCAGAAAGCAGCTTACTCTGGAAAAGTGAAAGATGTTTCGGTT TTCACCCATGAATTACGTTTGATAAAGTCGCCAGCAGAGCTGAAGCTAATGAGAGAGTCT GCATCAATTGCTTGCCAAGCTCTACTGCAGACAATGTTTCACTCAAAGACACATCCTTAT GAGGGTAGGCTATCAGCTAAGGTTGAATATGAATGCAAAATGAAGGGAGCCCAGAGAATG GCATTCAATCCTGTGGTTGGTGGCGGGCCTAATGCTAGTGTAATACATTATTCTCGGAAT GATCAGAAAATAAAAAATGGGGATCTTGTCTTGATGGATGTTGGTTGTGAGCTTCATGGT TATGTCAGTGATATTACTCGCACCTGGCCACCCTTCGGCAGCTTTTCTTCAACACAAGAA GAGCTCTATGATCTTATTCTGCAAACAAACAAGGATTGTGTGGAGCTTTGCAAACCTGGT GCTAGCATTCGAGAAATACACAACTTTTCAGTTGAAATGCTTATCAAAGGACTCAACGAG ATTGGAATTCTGAAGGATTCTAGAAGCAGTTCCTACCATCAGCTGAACCCAACTTCCATA GGTCACTATCTAGGAATGGATGTCCATGATTGTTCTATCGTTGGTTATGACCGTCCTTTG AAGCCAGGCGTTGTGATAACAATTGAACCAGGAATCTACATCCCATTGTCTTCTAATGGT CCTGAGAGGTTTAGAGGGATCGGGATAAGGATTGAGGATGAGGTCCTCATTACAGATACA GGTTATGAGGTCCTGACGGGGTCGATGCCGAAAGAAGTTAAACACATTGAATCCTTACTA AACAACTTTCCCCATGCAGAGATCAAGAGCAAGGCTGATGAGCTGTACCATGGAGATGAG CTCTGCCAAGAAAATTCAAAAAGATTGCTCACAGAAATCAGCCTGCCCAATGGCCTCTTG CCCTTGAAAGACATGGAGGAATGTGGTTATGTGAAGGAGACTGGATTTGTGTGGCTTAAG CAGAAGAAGAGCACAACCCACAAGTTTGAAAAGATTGGGAAGCTGGTCAGTTATGCCCCT GAAGTCACAGCCTATGTTGAGAAAGGCAAGATCAAGAAGCTCACTGGGGTCAAGACCAAG GAGCTCTTGGTTTGGGTGACACTCAGTGACATTTACGTTGATGACCCTCCAACTGGGAAA ATCACTTTCAAGACTCCTTCTGGGCTTTTTAGGACTTTCCCTGCGTCAGTTTTTGAGAGT GAGGAAGCTGCTAACAAGGATGTCAAGGACAAGAAGGGAGTGAAGGCAGCCAAGGGAGTT GTAGAAGTCTAA
PEP MASSENVASMMEPWAFRTNTFADSWISETFSRDTKTLTRALQKSLSNNPESLDSSSDMFM PFLNNILQPETAPTPTVSGLSGSEDPDTSPAPPKRQQRNAIPVSGAGGGKVSKRKSRAAK RSQTTFITADPSNFRQMVQQVTGVRFGNEQVPLPSILKPEPQRLGSRLPGIGCCMPTLDT SAFLLEHHNQQQQQLVGPTTMTGAGLNTTLTGLGPASFGQTSIGEDVASAGGVASGGLGF DSFSSFPTLESWKAIGRRAYSTKKIVDIGQPSPASHPQLLKEGEITPGITSEEYTLRRNK LLEVLPEKGLAIFAAAPVKMMTDVVPYTYRQDADYLYITGCQQPGGVAVLGHECGFCMFM PEATSHDVIWQGQIAGVSAALEVFKADRAYPMSKLRQILPDIMKGSSELFHNVQTAVPTY MELDAFQKAAYSGKVKDVSVFTHELRLIKSPAELKLMRESASIACQALLQTMFHSKTHPY EGRLSAKVEYECKMKGAQRMAFNPVVGGGPNASVIHYSRNDQKIKNGDLVLMDVGCELHG YVSDITRTWPPFGSFSSTQEELYDLILQTNKDCVELCKPGASIREIHNFSVEMLIKGLNE IGILKDSRSSSYHQLNPTSIGHYLGMDVHDCSIVGYDRPLKPGVVITIEPGIYIPLSSNG PERFRGIGIRIEDEVLITDTGYEVLTGSMPKEVKHIESLLNNFPHAEIKSKADELYHGDE LCQENSKRLLTEISLPNGLLPLKDMEECGYVKETGFVWLKQKKSTTHKFEKIGKLVSYAP EVTAYVEKGKIKKLTGVKTKELLVWVTLSDIYVDDPPTGKITFKTPSGLFRTFPASVFES EEAANKDVKDKKGVKAAKGVVEV


| Top |