Cherry SNP DataBase

Gene information

Gene Pav_sc0001240.1_g070.1.mk
Chromosome name PAV_r1.0chr3
start 22457968
end 22462273
PAV_r1.0 name Pav_sc0001240.1
start 44087
end 48392
direction +
Annotation NR PREDICTED: lysine histidine transporter 1-like
Sequence CDS ATGGGAACCCAAGCTCCAACTGACCAGAACAATTATGCCTCTACAGATATTGATGCAAAA TTAGCGAAGCAGAAGGCGATCGATGATTGGCTTCCAATTACTTCTTCAAGGAATGCAAAA TGGTGGTACTCAGCTTTCCACAATGTCACAGCCATGGTCGGAGCTGGTGTTCTCAGTCTC CCTTATGCCATTTACTCTACCATTGCTTGGGCAGCTTCTGTAAACAAGGGTGTGGTAGAC AATGTTCAATACGGATATAAAGCCAAGTCTACATCAGGAACTGTGTTCGGCTTCTTCAAT GCCTTGGGGGAAGTGGCTTTTGCTTATGCCGGGCACAATGTGGTTCTGGAAATACAAGCA ACAATTCCATCGACGCCGGAGAAGCCTTCCAAGGGACCCATGTGGAGAGGAGTAATTGTT GCCTATATAGTTGTGGCTTTGTGCTACTTCCCAGTTGCTCTCATCGGCTATTATATATTT GGCAATTCAGTTGACGATAATATCCTCATCTCACTAGAAAAACCTTCGTGGCTCATTGCA ATGGCCAACATGTTTGTTGTCATCCATGTTATTGGAAGCTATCAGATTTATGCAATGCCA GTGTTTGACATGATAGAAACTGTATTGGTAAAGAAGTTAAATTTCAGACCCACCAGAACG CTTCGCTTCATTACGCGCAATATATATGTCGCTCCCTTGCATAATGTGGCTTGCCATCTA CAAACCAAGAAAGTTCAGCTTGTCTTGGTGATTTGCATCTTTTTTGGTGTTCTTTTGATG ATCCTTTCACCTATTGGAGGATTGAGAACAATCATAATTGAAGCCAAGAACTACACATTT TACTCATAA
PEP MGTQAPTDQNNYASTDIDAKLAKQKAIDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSL PYAIYSTIAWAASVNKGVVDNVQYGYKAKSTSGTVFGFFNALGEVAFAYAGHNVVLEIQA TIPSTPEKPSKGPMWRGVIVAYIVVALCYFPVALIGYYIFGNSVDDNILISLEKPSWLIA MANMFVVIHVIGSYQIYAMPVFDMIETVLVKKLNFRPTRTLRFITRNIYVAPLHNVACHL QTKKVQLVLVICIFFGVLLMILSPIGGLRTIIIEAKNYTFYS


| Top |