Cherry SNP DataBase

Gene information

Gene Pav_sc0001258.1_g060.1.mk
Chromosome name PAV_r1.0chr1
start 34277206
end 34278500
PAV_r1.0 name Pav_sc0001258.1
start 36743
end 38037
direction +
Annotation NR PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1
Sequence CDS ATGGGTTCTGATTCTCAATGCCGGATACCGGCCATAGAGTTGTCGATCAATTCAGTGGGA TTCGAACGTGGAACTGATGATTGGCACCATTTGAGCAAGAGTGTTAGAGAGGCTTGTGAA AATTATGGTTGTTTTGAAGTAGCGTATGATAAGATACCTCTGCAGTTGAGAGCAGAGACC TTCTCAGTGATAAAGGAACTTTTCAGCCTTCCATTAGAGGCAAAGCAGAAGAATATTAAT CCAAAGCCTTACCATGGTTACTATGGACAGTATGCAAGTATTCCCTTGTATGAGAGCTTT GGCCTTAAAGATTCCTCCAACTATGACTCCCTTAAAAGCTTCACAGAGCTGATGTGGCCT AGTGGTCATGACCAGTTTTGTAACAGTGTAGTTACCATGATGAAGAAGCTGGATGAGCTG AAGGATATGATTGACATGATGATTCTTTACAGTTATGGTTTGGGAGAGATTGAATTCGAT CGTGCCAACACAATACTTTGTGATGATCAAGTTTCTGGGCTTGAATTTGAAACCAAGGAT GGACAATGGAACAAGTTATCTCTATCTCCTAGCTCCTTCATCTTCTTTGTTGGAGATCCT CTTATGAATGCATCCGTGAAGCATCGTGTGATGATGTCTGGAGAAAAAGATCGATACTCT CTAGCAGCATTTGCAGTTCCAGTTGAGGGTACCATCATCAAGGCACCAAAGGAGTTAGTT GATGAAGAATATCCTCAAATTCTCAAAGAATTTGACTACATGGATTTTACCAAGTTCTCC TATTCAGAGGAAGGAAGGGCCATAGATTCAGCAAGGCAAGTTTTTGTGTTTGCTGGAATT AGCACTCGAGAACAAGACAATGGCTCTGGCAGAACATGA
PEP MGSDSQCRIPAIELSINSVGFERGTDDWHHLSKSVREACENYGCFEVAYDKIPLQLRAET FSVIKELFSLPLEAKQKNINPKPYHGYYGQYASIPLYESFGLKDSSNYDSLKSFTELMWP SGHDQFCNSVVTMMKKLDELKDMIDMMILYSYGLGEIEFDRANTILCDDQVSGLEFETKD GQWNKLSLSPSSFIFFVGDPLMNASVKHRVMMSGEKDRYSLAAFAVPVEGTIIKAPKELV DEEYPQILKEFDYMDFTKFSYSEEGRAIDSARQVFVFAGISTREQDNGSGRT


| Top |