Cherry SNP DataBase

Gene information

Gene Pav_sc0001258.1_g390.1.mk
Chromosome name PAV_r1.0chr1
start 34098386
end 34106667
PAV_r1.0 name Pav_sc0001258.1
start 208576
end 216857
direction +
Annotation NR PREDICTED: RING finger and CHY zinc finger domain-containing protein 1
Sequence CDS ATGGTTAGACAGAACAAAATGGAGGATGCCCATTTGAATCTATCGTGCATGCTCACTGTA GAATCAAAAGTAGAATCAAAGGATACTGGAAAGGCCACTGAATTGTTGGAGAGAGGACAT ATGGAGTATGGATGTCCACACTACAGGCGAAGGTGCCGCATTAGAGCTCCTTGCTGCAAT GAGATTTTTGATTGTCGCCATTGTCATAATGAAGCAAAGAACGATATTAATGTCGATCAG AAGCATAGGCATGACATACCACGTCATCAAGTCAAACAGGTGATATGTTCACTTTGCGGC ACTGAGCAAGAGGTTGGACAAGTTTGTGTTAACTGTGGTGTATGCATGGGGAAATACTTC TGTGGGACTTGCAAGCTATTCGATGATGATACGTCTAAGAGACAGTACCACTGCAATGGA TGTGGAATATGCAGAATCGGAGGGCGTGAGAATTTCTTCCACTGCTACAAGTGTGGCTGC TGCTACTCAATTATGTTGAAAAACAGCCACCCTTGTGTGGAAGGAGCAATGCATCACGAC TGCCCTGTTTGCTTTGAGTTCTTATTTGAATCAACAAATGATGTTACGGTGATGCTGTGT GGACACACTATTCACAAGGATTGCTTAAAAGAGATGAGGGAGCATTATCAATATGCGTGC CCTCTTTGCTCCAAATCAGTTTGTGATATGTCCAAGGTATGGGAGAAATATGACATGGAG ATTGCAGCTACACCAATGCCTGAACCATATAAAAACAAATTGGTTTGGATCCTCTGCAAC GACTGTGGGAAAAGCTCACAAGTGCAGTACCATGTTGTGGCCCAGAAATGCCTGAACTGT AAATCCTACAACACTCGCCAAACGAGAGGCTGA
PEP MVRQNKMEDAHLNLSCMLTVESKVESKDTGKATELLERGHMEYGCPHYRRRCRIRAPCCN EIFDCRHCHNEAKNDINVDQKHRHDIPRHQVKQVICSLCGTEQEVGQVCVNCGVCMGKYF CGTCKLFDDDTSKRQYHCNGCGICRIGGRENFFHCYKCGCCYSIMLKNSHPCVEGAMHHD CPVCFEFLFESTNDVTVMLCGHTIHKDCLKEMREHYQYACPLCSKSVCDMSKVWEKYDME IAATPMPEPYKNKLVWILCNDCGKSSQVQYHVVAQKCLNCKSYNTRQTRG


| Top |