Cherry SNP DataBase

Gene information

Gene Pav_sc0001270.1_g270.1.mk
Chromosome name PAV_r1.0chr4
start 24820555
end 24831124
PAV_r1.0 name Pav_sc0001270.1
start 182391
end 192960
direction -
Annotation NR PREDICTED: E3 ubiquitin-protein ligase HERC2
Sequence CDS ATGTCGCGGACTGATAGGATGCCTTCCGATCTTAGCAGGACCGGGCCGGTCGAAAGAGAC ATCGAGCAGGCTATTACTGCTCTGAAGAAGGGGGCATACTTGCTCAAGTATGGAAGAAGG GGGAAGCCTAAGTTTTGTCCCTTCCGTCTTTCCAATGATGAATCAGTTCTAATATGGTTC TCTGGGAAAGAGGAAAAGCACCTTAAGCTGAGCCACGTGTCTAGAATTATTACTGGGCAA CGCACCCCAATCTTTCAAAGGTATCCACGCCCTGAGAAGGAGTATCAGTCATTTTCTTTA ATATATAATGACAGATCACTAGATTTGATTTGTAAGGATAAAGATGAAGCTGACGTATGG TTTAGTGGTTTAAAAGCATTGATATCCCGCAGCCAACATCGAAAATGGAGAACAGAGTCA AGGAGTGATGGAATTCCATCTGAAGCCAATAGTCCTAGAACATACACGCGTAGAAGTTCT CCTCTTAATTCTCCATTTGGTAGTAATGATAGCTTGCAGAAGGATAGTGCAGATCACCTT CGCCTTCATAGTCCATATGAAAGTCCTCCTAAAAATGGTCTGGATAAGGCACTATCAGAT GTTATACTGTATGCTGTTCCTCCCAAGGGTTTCTTCCCTTCAGATTCAGCCAGCGGTTCA GTACATTCTGTGTCATCTGGTGGCTCAGATAGCGTACATGGGCAGATGAAGGCAATGGCA ATGGATGCTTTTAGAGTTAGTCTATCCAGTGCTGTTAGCTCATCAAGCCAAGGATCTGGA CATGATGATGGTGATGCCTTGGGGGATGTTTTCATGTGGGGAGAAGGCACAGGAGATGGT GTTGTGGGTGGTGGTTCTCATAGAGTTGGAAGTAGTAATGGTGCAAAAATGGATTCTTTG TTGCCCAAAGCCTTAGAATCTGCAGTTGTACTTGATGTCCAAAACATCGCCTGTGGTGGA CGACATGCTGCTTTAGTGACTAAGCAAGGGGAGATTTTCTCTTGGGGAGAGGAATCTGGA GGCAGGCTTGGGCATGGTGTTGATGTTGACGTTTTGCATCCAAAGCTCATTGATGCACTT AGTAGTATGAACATTGATCTTGTTGCTTGTGGTGAGTACCATACTTGTGCTGTTACTCTT TCTGGTGATCTGTACACATGGGGTGATGGAACTTACAATTTTGGTCTACTTGGACATGGA AATGAAGTGAGTCACTGGGTGCCCAAAAAGGTGAATGGACCCTTAGAGGGTATACATGTC TCATCAATATCTTGTGGACCCTGGCACACGGCTGTTGTAACCTCGGCTGGGCAATTGTTT ACTTTTGGTGATGGTACTTTTGGTGTTCTAGGCCATGGAGATCGAAAAAGTGTTTCAATT CCCAGGGAAGTGGAAAACCTAAAGGGCCTTCGCACTGTGCGAGCAGCTTGTGGTGTTTGG CATACTGCTGCCGTTGTAGAAGTCATGGTTGGGAATTCAAGTTCCAGTAACTGTTCTTTA GGAAAGTTGTTCACTTGGGGTGATGGTGATAAGGGTAGGCTTGGGCATGGTGACAAGGAA GCAAAACTTGTGCCTACCTGTGTTGCTGCTCTTGTAGAACCCAACTTTTGTCGAGTTGCT TGTGGACATAGTATGACAGTTGCACTTACAACGTCTGGCCATGTCTACACAATGGGCAGT CCTGTTTATGGTCAGTTAGGAAATCCTCAAGCTGATGGAAAGCTCCCCACTCGAGTTGAG GGAAAGCTCTCGAAGAGTCGTGTGGATGAGATTGCTTGTGGTGCCTATCATGTTGCAGTT TTAACTTCAAGAACTGAAGTTTATACTTGGGGAAAAGGAGCAAATGGTCGTTTAGGTCAT GGGAATATAGATGATCGGAGTTCCCCAACATTGGTTGAAGCTCTGAAAGATAAACAAGTC AAAAGTATTGCTTGTGGTGCGAATTTTACTGCGGCTATCTGCCTTCATAAATGGGTTTCA GGAGTCGATCAGTCAATGTGTTCGGGTTGCCGCCTTCCATTTAACTTTAAAAGAAAGCGC CATAATTGTTATAACTGTGGGCTTGTGTTTTGTCATTCATGCAGCAGTAAGAAGTCGCTT AAGGCTTCTATGGCACCAAACCCCAACAAACCTTATCGTGTCTGTGATAACTGCTTTAAT AAACTGAGAAAAGCTGCTGAAACTGATACTTCTTCGCAAACTTCTATGAGCAGAAGAGGA AGTATCAATCAGGGGTCAAATGAGCTTATTGATAAAGATGATAAATTGGACTACAGATCT CGTGCGCAACTTGCCAGATTTTCTTCGATGGAATCTCTGAAGCATGTGGAAACCCGTTCT TCAAAGAAAAATAAAAAACTAGAATTTAACAGCAGTCGAGTCTCACCTGTTCCAAATGGA GGTTCACAGTGGGGAGCTCTCAATATTTCTAAATCTTTTAATCCAGTATTTGGGTCATCG AAGAAGTTTTTCTCAGCTTCTGTCCCTGGATCAAGAATTGTTTCTCGAGCTACATCCCCA ATTTCGAGGCGCCCGAGCCCACCTCGTTCTACAACACCAACTCCAACTCTGGGTGGACTT ACATCACCAAAGATTGTTGTAGATGATGCTAAAAGGACAAATGAAAGCCTTAGCCAGGAG GTTATCAAACTGAGATCACAGGTTGAAAGTCTTACTCGAAAAGCCCAACTACAAGAGGTT GAGCTGGAAAGAACAACTAAGCAGCTGAAGGAAGCAATAGCAATTGCGGGTGCAGAGACT GCAAAATGCAAAGCAGCAAAGGACGTGATCCAGTCACTTACCGCCCAATTGAAGGACATG GCTGAAAGGCTGCCTGTTGGAGCAGTGCGGAATATTAAATCACCTTCTCTTGCTTCTTCC TTGGGTTCTGATCCTTCCAATGAAGTTTCTTGTCCTTTGACTGACCGATTGAATGGTCAA GTAACATGCCAAGAACCAGACTCCAATGGATCAAATAGCCAGTTGCTTTCTAACGGGTCC AGCACCACCGGTACCCGCAGTTCAGGTCACAGCAAACAAGTCCATCCCGATGTAGCAACT AGAAACGGGAACAGAATTAAAGAAAACGAATCTCGTCATGAATCTGAATGGGTTGAGCAA GATGAGCCTGGTGTATATATTACACTGACTTCCCTACCAGGAGGTGCAAAGGATCTCAAG CGAGTCCGCTTCAGTCGGAAGCGATTTAGTGAGAAACAAGCAGAAGATTGGTGGGCAGAG AACCGGGCAAGAGTGCATGAACAATACAATGTGCGCATGGTAGACAAGTCTAGTGTAGGC GTCGGGAGTGAGGACTTGGCTCGCTGA
PEP MSRTDRMPSDLSRTGPVERDIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWF SGKEEKHLKLSHVSRIITGQRTPIFQRYPRPEKEYQSFSLIYNDRSLDLICKDKDEADVW FSGLKALISRSQHRKWRTESRSDGIPSEANSPRTYTRRSSPLNSPFGSNDSLQKDSADHL RLHSPYESPPKNGLDKALSDVILYAVPPKGFFPSDSASGSVHSVSSGGSDSVHGQMKAMA MDAFRVSLSSAVSSSSQGSGHDDGDALGDVFMWGEGTGDGVVGGGSHRVGSSNGAKMDSL LPKALESAVVLDVQNIACGGRHAALVTKQGEIFSWGEESGGRLGHGVDVDVLHPKLIDAL SSMNIDLVACGEYHTCAVTLSGDLYTWGDGTYNFGLLGHGNEVSHWVPKKVNGPLEGIHV SSISCGPWHTAVVTSAGQLFTFGDGTFGVLGHGDRKSVSIPREVENLKGLRTVRAACGVW HTAAVVEVMVGNSSSSNCSLGKLFTWGDGDKGRLGHGDKEAKLVPTCVAALVEPNFCRVA CGHSMTVALTTSGHVYTMGSPVYGQLGNPQADGKLPTRVEGKLSKSRVDEIACGAYHVAV LTSRTEVYTWGKGANGRLGHGNIDDRSSPTLVEALKDKQVKSIACGANFTAAICLHKWVS GVDQSMCSGCRLPFNFKRKRHNCYNCGLVFCHSCSSKKSLKASMAPNPNKPYRVCDNCFN KLRKAAETDTSSQTSMSRRGSINQGSNELIDKDDKLDYRSRAQLARFSSMESLKHVETRS SKKNKKLEFNSSRVSPVPNGGSQWGALNISKSFNPVFGSSKKFFSASVPGSRIVSRATSP ISRRPSPPRSTTPTPTLGGLTSPKIVVDDAKRTNESLSQEVIKLRSQVESLTRKAQLQEV ELERTTKQLKEAIAIAGAETAKCKAAKDVIQSLTAQLKDMAERLPVGAVRNIKSPSLASS LGSDPSNEVSCPLTDRLNGQVTCQEPDSNGSNSQLLSNGSSTTGTRSSGHSKQVHPDVAT RNGNRIKENESRHESEWVEQDEPGVYITLTSLPGGAKDLKRVRFSRKRFSEKQAEDWWAE NRARVHEQYNVRMVDKSSVGVGSEDLAR


| Top |