Cherry SNP DataBase

Gene information

Gene Pav_sc0001275.1_g050.1.mk
Chromosome name PAV_r1.0chr1
start 35441257
end 35450162
PAV_r1.0 name Pav_sc0001275.1
start 40851
end 49756
direction +
Annotation NR PREDICTED: uncharacterized protein At1g21580
Sequence CDS ATGGACCTGCCTCAGTACCTTCACCAGCACCCAAGGTACGCTCCTTCTCATCCCTACCCA GCCGACCCCCTGAATTTCCCAAACTATCCTCACCGCCACCACAACAACCACCACTACAAC CACCACCATCACCAGCAACCACCACTACAAATCCAACCACCGCCGCCTCCACAGCCACCA CTACCCCCAACGTCGTCGTATCACCCTCTGCCTCCACCTCCACCACCGCCGCCCCATCCC TACAACCCCAGCCAGCCCCAATTGCCCTTTGATTCCGAACATTCTAGAACCTTTCACTCT CTTCACGACTTCCCTGTCTCCTCGCCCCGTGTCTCCAGCCGAGTCACTCTCGATGCCGAG CGCCATCGCCATCATCGATTGCCCCAATTTGATCTTCCCTACCTCGAAAAGAATCCCGAT TCTTGGGACCCTTCGAGGGCTTATCTTGATTTCGAGCGTGATCGTGAATCGCATAAACCC CAGTTTAGGCTTGAATCAGAGGGTAGTGGTAGTGCTAGGTTTAGAAGCGAGTACAATGAA CAACTGCTCCGGGATCAGCGGGTGGTCGACGATGAGTATAATAATCGTCGCCGAGCTCGT GTAGAACCCAATTCTGAAATTGCTTATCGCGAATTGGGGTTTGTGTCGAATCAGAATTCG AATCATTTGAATTCCAATAATTTGGATTTTGATTCGAAATCCGGAGGTTATGATGGCAGG TATGATGAGTTGATGAGGAGTGGTGGTGGTAGGAGGGATGAAGTGTATGAGAATACTCAG AGATGGGTTCATCATGACAGACAAGCTAGTAGAGAGTTGTATGATCCGTTCGAGGTTGAT GAGACTAATGGGGGTCGGAATGTTTCAGGGAATCGGGAGTATTATGGTTCGGAATCAGGA AGAGGTAGTAGTAATAATAGGAGGAAGCAGATTCAGAAGAAGAGTGCTTTGCTCCGGCTG CAAATGGCAAAACCTAGTCACAAGAATCACTCTGCTTATTTTGATAATTCTGGCTCTAGT TCCCACAGAGGGAAAGGACATTATGAGTATTCGGATCGTGAGATGGATGAAGAAGAGAGA GGTGGGAGCCCTTTGGAACTTGATGTATCATTTAAATCGAATTCCCTAGTGGCAAAGACA GTTGGGAATAGGAATTTTAAGAGAGATTCAGTGTTTGACAGGGAATTTTCAAATTCTCAA CTCACTAAACTCAGTGAGGATGCTGTACATTTGGATAGCTCTGTAGTTGTTGAGGATATG ACATCCAATTCAGACAAGGACCTGCGACTGTTGGAAGAGGAAGTGACTACTTCTGGTGTT GAGAGTAGGTGTGATATCGATTCACAGCCGTGTTCTAATGTGACTGATGATTCGTTTGGA AAGAGTGAAGTGGAAAGGGCTTCAAAAAGCAAGGTTTTACAAAGAGCTGATAAAAGTGCT GGTTCTGGTCAAATGCCCTCTCTCAAGGTTTCTAAGAAGAAAAAAGTGGCAAAGAAAGTA GTGAAAAAGGTCATAAATCCTCAACCACTGCCAAAAAATAAGATTGATGAACCTGGGGTA GCAGATAGCTTTATTTGTAGACCATCTGCAGCTTTTGGGGCTGACAGGGGCGAAACCTCT TCTTTTGCTGATCCATGTTCAAATGATGTGCATGCGTTGCCTGTAAATAAAAAAGTAGAT GGCTCTTCCCTAAACATGTTATCAGATGAGCATGGCACTGAAGCCAACTCTTGTAGTAAG AGTACTGGGAGCAACTCAACTTCAAAATTGGGTTCTTCGAATCATGAAGAATTTAACATT GATCAGGGTCCTCTGACTGTAGATACTTCTGTCCAGGGCTTGCTTACGATTTCAAATTTT AGCAACAATGTAACTGATTCACTTAGGGTAGCTAGTTGTCCTGAAACTGATGGTGTTATA GATGTCAGCAAACAGATTTGTCACAGTGGTAACAGTTTATCCCTTGATAATGTCATCCGA AAAGAATCATCAGAGGCCATGCTATCTGTAGAAGGCAATGCCAATTCTGGTTTTTTAAGT TCAGAGAAAATTATGATGCATGACGACATTATGAATGCAAATGGTTCAGGCCATGGTACA GAAACCACCTTGGATATTGAGAGTGGGAGAAATGTGTTACATCAGGAAATAATTGTTCAT GACATTGGCACTGTGGATGCCATCAATGAGAATGTTTGTAAATATCAGTTCCCCACATCA CTTCAAATTGGTTTTGTGGAAGAACTTCCAAAGGGTATATCTTCAGCAGAAAGCAGCATG ACTGTTGGTTTGTCAAGTTCGGGGGAGACCTTAGCTGTTTGCTCCAATTCTGGTAGAGGT ACCACCTGGGATTCTGACAAAGTTTGTACTAATTATGATGAGAATATTATTGGTAAGCAA CCATCTGCAGATGGTGCCTCCAGATCATTTGGAATTTGTGCCACACAAAGATCTCCAGAT ATTACAAAGTCAGTTGGAGATAGTAAGGGTGTTACTCATAAGAATAAAAAGAAGAGAAAA GTTAGGTCTCGATTAGACTCTTCAAGGGCTTCCAACACTTGTGCAGAGCCTATAAATGTT TCCGTCAACAAAAATTCTGTGGATACAACAGTAAGTTCATCCCTGAAGGATGCTAGTCAT GCAGAAGTCGCTGTTTTTGGTGTTGGAAAGTTAGATATTGGCTCACAACGTGTTAATGAT GGGGTAAGTGTTATGCATGGGAAAAGCTCAGTAGATGGACTTTGTGAGGCTAAGTTATCA ACTAGAAGTGATGTTAACTGTGATCCCAATGAGACTTCACCGAAGTATATAAAGAAGAGA AAGTTATCTGCCTCTCATTTAGTATTGACTACATCTCAAACCAATGATGGACCTACAGAT AAATCTACATTTTATACAGATGCACCTTTGAAGTCTAATGATGTTCCAACACAAGAAGAA GACGAAGTTGCTGCTTCCAGCACAGGTCTTCTCCTTGCTACTGCTAATTTAATGCCTTCT CAAGAAGGAAGCACTGTATTTCTTAAGGATAATATAGCAGGAGTATTATCTGACGCTGTA GCTGCAGCTAGGGATGCCTTTACTAATGATGGTATGAAGTCTGAGCACCAAGGTGTGGAC TCCTGTTCAATTTATGAAGAGTCAGTTTCAGATACACTATTCCTTTGTCCATCACAATTG AGAAATGAGCAGAAAGAGGCAGGTACTCAAGTTATGGTCATAAATAATCATCACCTTGAC ATTATGGACATAGAAAGCAACCGTGAAGAAAATTTTGATATAGTTGCAACAGACGAGCAA GTTATTATACATGGTGAGACTGCTTTATGCAGAGTTTCTTCAGAAGTCGAGCCTCCAGAT TTAGGTTATAAATTTTCCTGCACAGATATGGAATCAGATTATGTCTCTGTGAAAGATACA TTGCCATTTGCTTCAAATCGTCTGCTGTTGTGCGCCAATGACAATGAAGTATCCACCACT AACTCTAATGATGAAGGGGTGGAGTCTGTGCCTGATACACTATCAGATACGGGTTCTCCA GAAACTTCAACTGATGTCCCTGGCGTGCAGATGCGAACTTGTAGTCCATCAGTTATTAAA ATTTCTGATGGAAAAGATTGTGGGGATGACCAGAAATTAGATTTGAAGTCTGTGGTTGAA GTTGGTTGCAGTGCATCTGCTCAAAATTCATTATCAGAGTGTACCAAATCTAATTTAACA CCACATCCTGTAACTGAAGGTGGCCAATCAGTCACGGGGAAGACAGTAGCTTTGCCATTG CAGGATATCAAAAAGACAGCTCATGGTTTGAATCTCGTAACTGCTGAATCTCGGTTGAAG AATCAGTTGGGTCAAGCTACTCATAGGATTGTTCCAGGTCATTCATATTCTGTGTTTTCT ACCTCAAAGAAGACTGGCTCGTCAAATCATATGGCAAAACCTCGGACTTGGCATCGAAAT GGTAATGCATCTGCATCTTCTCTTCCTGCAAGTATGCCTTTCTCGAGTACTGTTCCACCC CAAAGAATCTTACCACCAAAAGATGGAAAACTTCAGAGTAATTCTTATGTGCGTAAAGGC AACAGCCTTGTTAGAAAACCAGTTCCAGTTGCTGCTCTACCTCAAAGCTCTCATGGGTTT AGCTCAGCTGTTTATCGGTTGAACTCTTTAGGTATAGATGGGTTGAAGAAGAATGCAGGA TCTGACAGTAGGGTTGATGTTAAAAACCCTCCAAGTCTCGTGAGAACGGGAGAAATGAAT GCTCCTTTTGATAGGCCCAGACCCCTGTTGCCCAATGGAGCCAAATTATCTACTTATGAT GCCATCTCTTTGGGGGTTCGTACATCATCCCAATTGGCTGAGCCTCTTCTTAGTGGTGAA ACTACGTCAGATCCTATGAATTGTTTGGAAACTAAAGATGCAAAAATTGTTGTCAATGAC TCACTGGTAACTTCTGAAACTCAGGAAAATCTTAGTGGTCCATTCAACAGTTTGGAAAAC CAGACGGAACTACATGATGGGAATTTGGCGCCTTCAAATACGAAGAATATTGTCTATGTA AAGCGCAAGTTAAATCAGTTGGTTGCATCTTCCAGTCCTTGTGACCTTCCTGTCCACAAT GCTGATAAGATCCAACACTCATCCTTTGACGGCTACTACAAGAGGCGCAAAAATCAGCTA ATTAGGACATCTTCAGAAGGTCATGCTAAACAGGCAGTTATCATGTCCAATGACAATTTA AACTCACAGGTGCAAAAGGTTCCTAAGATTGTCCCCAGCAGAATATATGGCAAGAAGCGA TCACAGAAGGTTATTGCAAAGACAAGTAAAACTGGAAAAAACTCTTTGGTGTGGACGCCA CGTGGTACACAGGCATCGAACAATGATGGTGATTCATTTGACCATCAGAAGGTATTGCCT CACCTGTTTCCGTGGAAAAGAGCAAGACACTGGAGGACTTCCATGCAAAGTCAGGCTTCC AATTTCAAATATAGTTCTGCATCAACAATCAGTAAAAAACTGCTGCTGTCAAGAAGGCGG GATACTGTATACACTAGGTCAACCCATGGATTTTCACTTAGAATGTACAAAGTATTAAGT GTTGGTGGGTCCAGTTTAAAATGGTCAAAATCCATTGAAAGTCGCTCAAAGAAAGCTAAT GAGGAAGCTACACGTGCTGTTGCTGCAGTAGAGAAGAAGAAAAGAGAACACAGTGGTGCT GCTTGCGTTGGTTCTGGGTCTAAATTTAGAAATAATATATCGGGAAAACGTATATTCCGC ATTGGTTGTGTCCGTTACAAAATGGATCCTTCAAGGCGAACACTTCAGAGAATTTCAGAT GACGGATCATCAAGCTCTGCTGTGCTCAATCCAGAAAAGGATGCCAAGAGATCTTATGTT CCAAGGAGATTGGTGATCGGCAATGATGAATATGTGCGGATTGGCAATGGTAATCAGCTT ATCAGAAATCCGAAGAAACGAACTCGCATATTGGCTAATGAAAGAGTTCGATGGAGTTTG CACACTGCCAGACTGCGGTTGGCAAAGAAGCGGAAGTACTGTCAGTTTTTTACGAGATTT GGCAAGTGCAACAAGGATGATGGAAAATGCCCCTATATTCATGATCCCTCTAAAATTGCA GTCTGCACAAAGTTTTTGAAGGGGTTGTGTTCCAATCCCAACTGCAAGTTGACTCATAAG GTCATTCCCGAAAGAATGCAGGACTGTTCTTACTTTTTGCAAGGTTTGTGCTCCAATGAA AGTTGTCCTTACAGACATGTAAATGTGAATCCAAAGGCATCTACTTGTGAAGGATTTCTT AAGGGATATTGTGCTGACGGGAATGAGTGCCGGAAGAAGCACAGCTATGTCTGCCCGTCT TTTGAAGCAACTGGAACCTGTCCTCATGGTCCTAAATGCAAGCTTCACCACCCCAGAAAC CGAACAAAGGGAAAGAAAAGGAAACGAACAAGAGAACAAAAAAACGCTTGGGGCCGTTAC TTTGTATCCAAGGATATCAATTTTTCTGAGCCGAGAGCAGTGTCTGGAAAGCACTGTGCA CAAAATGGTGATGGCATATTTGATGATGGAAGGGCTGCTGATTTCATTAGCATTGATGCT AGTGATGAGGAGGCCGGAGAAAGCAATGATCCAATAAACGAGCAAGCTGCATCGTGCGAC AGTGATTCCTCTGAATTAGAATTAGATGACCTTGATGAGCTAATTAAACCGGTTCGTTTA CTGGACAGGAGTCTGAAGACAAACATCTTATAA
PEP MDLPQYLHQHPRYAPSHPYPADPLNFPNYPHRHHNNHHYNHHHHQQPPLQIQPPPPPQPP LPPTSSYHPLPPPPPPPPHPYNPSQPQLPFDSEHSRTFHSLHDFPVSSPRVSSRVTLDAE RHRHHRLPQFDLPYLEKNPDSWDPSRAYLDFERDRESHKPQFRLESEGSGSARFRSEYNE QLLRDQRVVDDEYNNRRRARVEPNSEIAYRELGFVSNQNSNHLNSNNLDFDSKSGGYDGR YDELMRSGGGRRDEVYENTQRWVHHDRQASRELYDPFEVDETNGGRNVSGNREYYGSESG RGSSNNRRKQIQKKSALLRLQMAKPSHKNHSAYFDNSGSSSHRGKGHYEYSDREMDEEER GGSPLELDVSFKSNSLVAKTVGNRNFKRDSVFDREFSNSQLTKLSEDAVHLDSSVVVEDM TSNSDKDLRLLEEEVTTSGVESRCDIDSQPCSNVTDDSFGKSEVERASKSKVLQRADKSA GSGQMPSLKVSKKKKVAKKVVKKVINPQPLPKNKIDEPGVADSFICRPSAAFGADRGETS SFADPCSNDVHALPVNKKVDGSSLNMLSDEHGTEANSCSKSTGSNSTSKLGSSNHEEFNI DQGPLTVDTSVQGLLTISNFSNNVTDSLRVASCPETDGVIDVSKQICHSGNSLSLDNVIR KESSEAMLSVEGNANSGFLSSEKIMMHDDIMNANGSGHGTETTLDIESGRNVLHQEIIVH DIGTVDAINENVCKYQFPTSLQIGFVEELPKGISSAESSMTVGLSSSGETLAVCSNSGRG TTWDSDKVCTNYDENIIGKQPSADGASRSFGICATQRSPDITKSVGDSKGVTHKNKKKRK VRSRLDSSRASNTCAEPINVSVNKNSVDTTVSSSLKDASHAEVAVFGVGKLDIGSQRVND GVSVMHGKSSVDGLCEAKLSTRSDVNCDPNETSPKYIKKRKLSASHLVLTTSQTNDGPTD KSTFYTDAPLKSNDVPTQEEDEVAASSTGLLLATANLMPSQEGSTVFLKDNIAGVLSDAV AAARDAFTNDGMKSEHQGVDSCSIYEESVSDTLFLCPSQLRNEQKEAGTQVMVINNHHLD IMDIESNREENFDIVATDEQVIIHGETALCRVSSEVEPPDLGYKFSCTDMESDYVSVKDT LPFASNRLLLCANDNEVSTTNSNDEGVESVPDTLSDTGSPETSTDVPGVQMRTCSPSVIK ISDGKDCGDDQKLDLKSVVEVGCSASAQNSLSECTKSNLTPHPVTEGGQSVTGKTVALPL QDIKKTAHGLNLVTAESRLKNQLGQATHRIVPGHSYSVFSTSKKTGSSNHMAKPRTWHRN GNASASSLPASMPFSSTVPPQRILPPKDGKLQSNSYVRKGNSLVRKPVPVAALPQSSHGF SSAVYRLNSLGIDGLKKNAGSDSRVDVKNPPSLVRTGEMNAPFDRPRPLLPNGAKLSTYD AISLGVRTSSQLAEPLLSGETTSDPMNCLETKDAKIVVNDSLVTSETQENLSGPFNSLEN QTELHDGNLAPSNTKNIVYVKRKLNQLVASSSPCDLPVHNADKIQHSSFDGYYKRRKNQL IRTSSEGHAKQAVIMSNDNLNSQVQKVPKIVPSRIYGKKRSQKVIAKTSKTGKNSLVWTP RGTQASNNDGDSFDHQKVLPHLFPWKRARHWRTSMQSQASNFKYSSASTISKKLLLSRRR DTVYTRSTHGFSLRMYKVLSVGGSSLKWSKSIESRSKKANEEATRAVAAVEKKKREHSGA ACVGSGSKFRNNISGKRIFRIGCVRYKMDPSRRTLQRISDDGSSSSAVLNPEKDAKRSYV PRRLVIGNDEYVRIGNGNQLIRNPKKRTRILANERVRWSLHTARLRLAKKRKYCQFFTRF GKCNKDDGKCPYIHDPSKIAVCTKFLKGLCSNPNCKLTHKVIPERMQDCSYFLQGLCSNE SCPYRHVNVNPKASTCEGFLKGYCADGNECRKKHSYVCPSFEATGTCPHGPKCKLHHPRN RTKGKKRKRTREQKNAWGRYFVSKDINFSEPRAVSGKHCAQNGDGIFDDGRAADFISIDA SDEEAGESNDPINEQAASCDSDSSELELDDLDELIKPVRLLDRSLKTNIL


| Top |