Cherry SNP DataBase

Gene information

Gene Pav_sc0001280.1_g060.1.mk
Chromosome name PAV_r1.0chr6
start 18102580
end 18106596
PAV_r1.0 name Pav_sc0001280.1
start 37857
end 41873
direction +
Annotation NR PREDICTED: CASP-like protein At3g53850
Sequence CDS ATGAAGGAGCTGATTGGGAGGCCTGGGTCGGTGAGTGGGTTATTGCTCAGGATAGGCCAA TTTTCATGCGCTTCTATTGCCATTTCAGTCATGGTCACCACTGCCGGCTTCGCTACCTTC ACTGCTTTCTGCTATTTGATTGCATCGATGGGGCTTCAACTGCTATGGAGCTTGGGGCTT GCTTGTCTTGATATTTATGCTTTGTGGAAAAAGAGAGACCTTCAAAATCCAATCCTAGTG AGCCTATTTGTTGTAGGTGATTGGGTAACAGCTACTTTATCACTAGCTGCTGCAAGCTCT TGTGCTGGGCTTACAGTTCTGTTTTCAAGAGACCTACATTTCTGCAGGGGTGAATACCAT TTGCCATGCATCAACTACAAGTTTGCAGTTGCGTTCGCTTTTGTCACCTGGGGCCTTACT GCCATATCTTCTCACGTGATGTTTTGGATCTTATTGGCATCGGTTTAG
PEP MKELIGRPGSVSGLLLRIGQFSCASIAISVMVTTAGFATFTAFCYLIASMGLQLLWSLGL ACLDIYALWKKRDLQNPILVSLFVVGDWVTATLSLAAASSCAGLTVLFSRDLHFCRGEYH LPCINYKFAVAFAFVTWGLTAISSHVMFWILLASV


| Top |