Cherry SNP DataBase

Gene information

Gene Pav_sc0001280.1_g250.1.mk
Chromosome name PAV_r1.0chr6
start 17998187
end 17999120
PAV_r1.0 name Pav_sc0001280.1
start 145333
end 146266
direction +
Annotation NR PREDICTED: high-light-induced protein, chloroplastic
Sequence CDS ATGGCAACTTCATCTACCATAATATCGTCTTCTCTCCTTCCCACCAGAGTTTTAACAGCA AATTCTCAAAACCAGAAACTCTGCCTTTTACGTAATGGGACTCTGCCTGGCACAGCCTCC AAAAGAAGTGCTGCCTTCAGAGTTCAAGCTGCCAAGCTTCCTGCTGGGGTGGTGGTGCCA AAAGTAGAGCCAAAATTTGAGCCCCCCTTCCTTGGGTTCACCAGGACTGCAGAAATATGG AACTCTAGAGCTTGCATGATTGGACTTATTGGAACTTTCATTGTAGAATTGATATTGAAC AAAGGAATATTACAGTTGATTGGAGTGGAAATTGGAAAAGGTCTTGATATTCCTCTGTGA
PEP MATSSTIISSSLLPTRVLTANSQNQKLCLLRNGTLPGTASKRSAAFRVQAAKLPAGVVVP KVEPKFEPPFLGFTRTAEIWNSRACMIGLIGTFIVELILNKGILQLIGVEIGKGLDIPL


| Top |