Cherry SNP DataBase

Gene information

Gene Pav_sc0001280.1_g390.1.mk
Chromosome name PAV_r1.0chr6
start 17918394
end 17919990
PAV_r1.0 name Pav_sc0001280.1
start 224463
end 226059
direction -
Annotation NR PREDICTED: laccase-17-like
Sequence CDS ATGGGTTCTCCTCATTTTCCTTGTTTCACTTCAATGGCAGCTTTGCTGTTTGGTTTTTTT GTTGCAGCGTCGTGGATGCCGGAGTTTGCTGCAGGCAAAACAAGACACTACACTTTCAAT TGGTTTAATGTAGACCCTGAGGCTGTGATTAGCCAGGCTCTTCAGACAGGAGGGGGGCCT AATGTTTCAGATGCATACACCATTAATGGTCTTCCAGGCCCCTTGTACAACTGTTCATCT AAAGGCACCTTAGACAACACCACCACCGCTGGAATCCTCGAATACAAGCTCCCAAACACC ACTCATCACACTTCCATCAAAGCCCTTCCCCTCTTCAGACCAAGTCTTCCACCCATCAAT GCCACCAAGTTTGTCAACGTCACCCAATTTGTCGAAAACTTAGCCAAAAAATTCCGTAGC TTGGCCACTAAGCAATTCCCAGCCAACGTCCCGCAAACTGTGGACAGAAGATTTTTCTTC ACTATAGGACTTGGAACATCCCCA
PEP MGSPHFPCFTSMAALLFGFFVAASWMPEFAAGKTRHYTFNWFNVDPEAVISQALQTGGGP NVSDAYTINGLPGPLYNCSSKGTLDNTTTAGILEYKLPNTTHHTSIKALPLFRPSLPPIN ATKFVNVTQFVENLAKKFRSLATKQFPANVPQTVDRRFFFTIGLGTSP


| Top |