Cherry SNP DataBase

Gene information

Gene Pav_sc0001289.1_g030.1.mk
Chromosome name PAV_r1.0chr4
start 4383931
end 4403876
PAV_r1.0 name Pav_sc0001289.1
start 20985
end 40930
direction -
Annotation NR PREDICTED: GDSL esterase/lipase At1g29670-like
Sequence CDS ATGGCTTGTGGCATGAAACTATTGTTGGTAGCAATTGCTCTATCTTTGGTGTTGAACACT CAACATTTTGTTCAGGGAAAGCCACAGGTGCGAGAGCCACAGGTGGAAGAGCCACAGGTG CCCTGCTTTTTCATATTTGGAGACTCTGTGTCTGATAATGGCAACAACAACTTGCTTCCC ACATTTGCCAAAGTCAACTACAGTCCCTATGGCGTTGACTTTCCTCAGGGCCCAACAGGA AGGTTCTGCAATGGCCGAAACATAGTTGATGTGCTTGCTGAGCTTCTGGGATTTGAAAAC TACATTCCACCATTTGCATATGCCAATGGCTCTGAAATAGTTAAAGGAGTGAATTATGCA TCTGGTGCAGCAGGAATTCGAAAAGAAAGTGGGAGTCAGTTGAGGTTGCGCAAGTATGGA GCAAGGAAGGTTTCTTTGGTTGGCCTGGGGCTAATTGGCTGCACCCCAGATGCAATTAAG ACCTATGGTACCAATGGATCTTCTTGTGTGGAAAAATTGAACAATGCATCCCAACAATTT AATCAAAAGCTTGTGGCTCTTGTTGATGAGCTCAACACCAATTTTACTGATTCAAAATTC ATCTATGTCAACAGCTATGAAATGGGCTCAGGGGACCCTACATTAGTTGTGGATGAATAT GGTCAATGTGCTCCTAACAAAACTCCATGCCAGAATAGGACTGATTATGTTTTCTGGGAC GGATTTCATCCTAGTGAGGCCTCCAATTTAATCACTGCCAGCAGAACCTACTCAGCTTAT AACGCTTCAGACACTTATCCAATGGATATCAGTCACTTAGTTCAGCTACAACTTGAGCCT CAAATAACATTAGGGTTCATCCTGATTGTTGTTTTCGTGGTTTCAATATCACAATCTCGT CTTGTTAATGGAGCACCACAAGTACCTTGTTTTTTCATTTTTGGTGATTCATTGGCTGAT AATGGCAATAATAACAACCTCCGGAGCTTTGCTAAAGTCAACTACCAACCTTACGGGATT GATTTTCCAACTGGACCGACAGGAAGATTTTGCAATGGCCGGACCACAGTTGACATACTA GCTCAACTGTTGGGTTTTGAGAACCCCATCCCATCATTTGCAGCTACTAGCTGCCCAGAC ATTTTAAAAGGTCTGAACTACGCATCAGGCTCAGCAGGAATTCGAACAGAAACTGGCTTC CAAATGAGCTTGTACAAGAATGGAGCGAGGAAGGTGGCCTTGATTGGATTGGGATCAATA GGCTGCACCCCAAATGCAATTTCAACATTTGGCACAAATGGGTCCGCATGTGTGAATTAT ATGAACAGTGCGGTCCACCTTTTTAACCAAAAGCTTTTAGCTCTAGTCAATCAGCTAAAC ACCAATCTGACCGATGCAAGATTCATCTATGTCAACAGCTTTGGAATGGCTTCAGGGAAC CCAGCAGCTGCTGGTTTCAAGGTTGTGAATGTTGGGTGCTGCCCAGTGAATAATTTTGGT CAATGTGCTGCTGGCCAAACTCCATGCCAGAACAGGAGTGAGTATGTGTTCTGGGATGGA TTTCATCCCACTGAGGCTTTGAATAAAATCACTGCAACAAGAACATACACCGAGTTTGAT CCGTCCGACACTTATCCGTTGGATATCAGTCACCTTGTTCAACTTATGCCAACAACAATA TTGTTCATGATGGTCGTCGTTTTGGTGGATCCAATTTGTGGAGCACCACGAGTTCCTTGT TTTTTCATTTTTGGTGATTCATTGGCCGATAATGGCAATAATAACAACCTCCTCACCACG GCCAGAGTGAACTACCAGCCCTACGGGATTGATTTTCTCACTGGACCAACCGGAAGGTTT TGCAACGGCCGGACCACCGTTGACATATTAGCTCAACTTCTGGGTTTTGAGAATCTCATC CCTCCATTTGCAACTAGCAATAAGGGTCCAGACATTTTAAAAGGTCTGAATTATGCATCT GGCGCAGCAGGAATTCGAGAATTATATATATATTACAGCTCAACTTCTGGGTCTGAATTA TGCATCTGGCGCGTAGTAGGAATTCGAATCGAAACTGGCTCCCAATTGATCAGCAATTAC TTAATCACCAAGTTACAGCCATACGCATTGCTTCCATACTTGGAAACTTTGAACGACAAG TATGGAGCAAGGAAGGTGGCCTTGGTTGGGCTGGGACTTATAGGCTGCACCCCAAATGCG ATTTCAACATTTGGAACGAATGGGTCTGCATGTGTTGATAAATTGAACAGTGCAGCCCAA ATGTTTAACCAAAAGCTTGTATCTTTGGTCGATCAGCTCAACGCCAATCTGAGAGATGCA AAATTCATCTATGTCAACAGCTTTGGGATGGGGTCGGGCGACCCTGCAGCTGCTGGGTTC AGGGTTGTTAATGTTGGATGCTGCCCAGTAAACAATATTGGTCAATGTGCTGCTGGCCAA ACTCCATGCCAAAATAGGAGTGAGTATGTGTTTTGGGATGGATTTCATCCTACTGAGGCC TTGAACCATATCACTGCAATAAGAACATATACTGCTTTTGATCCGTCCGATACTTACCCA ATGGATATCAGTCACCTCGTTCAGCTTAGTGAGTATGTGTTATGGGACGGATTTCATCCT ACTGAGGCTTTGAATCAAATCACTTCAAGAAGAACATACATTGAGTTTGATCCGTCCGAC ACTTATCCGTTGGATATCAGTCACCTTATTCAGCTTATGCCAACAACAATATTGTTCATG ATGGTCGTCGTTTTGGTGGATCCAATTCATGGAGCACCACAACTTCCTTGTTTTTTCATT TTTGGTGATTCATTGGCCGATAATGGCAATAATAACAACCTCCTCACCACAGCCAGAGTG AACTACCAGCCCTACGGGATTGATTTTCTCACTGGACCAACCGGAAGGTTTTGCAACGGC CGGACCACCGTTGACATATTAGCTCAACTTCTGGGTTTTGAGAATCTCATCCCACCATTT GCAACTAGCAATAAGGGTCCAGACATTTTAAAAGGTCTAAATTATGCATCTGGCGCTGCA GGAATTCGAGTCGAAACTGGCTCCCAATTGGGTGGTCATATCAGCTTAGATCAGCAATTA CTTAATCACCAAGTTACAGCCATACGCATTGCTTCTATACTGGGAAGTAACCAATCAGCT TTGCAGTATTTAAACAAATGCTTATATTCAACTTTGAACAACAAGTATGGAGCAAGGAAG GTGGCCTTGGTTGGGCTGGGACTTATAGGCTGCACCCCAAATGCGATTTCAACATTTGGA ACGAATGGGTCTGCATGTGTTGATAAATTGAACAGTGCAGCCCAAATGTTTAACCAAAAG CTTGTATCTTTGGTCGATCAGCTCAACGCCAATCTGAGAGATGCAAAATTCATCTATGTC AACAGCTTTGGGATGGGGTCGGGCGACCCTGCAGCTGCTGGATTTAAGGTTGTGAATGTT GGGTGCTGCCCAGTGAACAATATTGGTCAATGTGCTGCTGGCCAAACTCCATGCCAAAAT AGGAGTGAGTATGTGTTTTGGGACGGATTTCACCCCACTGAGGCCATGAACCAGATCACT GCAATAAGAACATACACTGCTTTTGATCCGTCCGATACTTACCCAACGGATATCAGGTGC TGCCCAGTGAACAATATTGGTCAATGTGCTGCTGGCCAAACTCCATGCCAAAATAGGAGT GAGTATGTGTTTTGGGACGGATTTCACCCCACTGAGGCCATGAACCAGATCACTGCAATA AGAACATACACTGCTTTTGATCCGTCCGATACTTACCCAATGGATATCAGTCACCTCACT TTGTATAGTTATGGAGCAAGGAAGGTGGCCTTGGTTGGAGTGGCACCAATAGGCAATGCA ACCGAACCTTTTAATGAAAAGCTTAGAGCTCTGGTGGACAAGCTCAACACGGATCTGGAA GATGCACAATTCATCTATGTTAACGCTTCTTCAGTGTCACGTCCTGCTGGTACTTGGTTA CACTTTTGTGCCTCTCTTTTCTGCTGTGATCCT
PEP MACGMKLLLVAIALSLVLNTQHFVQGKPQVREPQVEEPQVPCFFIFGDSVSDNGNNNLLP TFAKVNYSPYGVDFPQGPTGRFCNGRNIVDVLAELLGFENYIPPFAYANGSEIVKGVNYA SGAAGIRKESGSQLRLRKYGARKVSLVGLGLIGCTPDAIKTYGTNGSSCVEKLNNASQQF NQKLVALVDELNTNFTDSKFIYVNSYEMGSGDPTLVVDEYGQCAPNKTPCQNRTDYVFWD GFHPSEASNLITASRTYSAYNASDTYPMDISHLVQLQLEPQITLGFILIVVFVVSISQSR LVNGAPQVPCFFIFGDSLADNGNNNNLRSFAKVNYQPYGIDFPTGPTGRFCNGRTTVDIL AQLLGFENPIPSFAATSCPDILKGLNYASGSAGIRTETGFQMSLYKNGARKVALIGLGSI GCTPNAISTFGTNGSACVNYMNSAVHLFNQKLLALVNQLNTNLTDARFIYVNSFGMASGN PAAAGFKVVNVGCCPVNNFGQCAAGQTPCQNRSEYVFWDGFHPTEALNKITATRTYTEFD PSDTYPLDISHLVQLMPTTILFMMVVVLVDPICGAPRVPCFFIFGDSLADNGNNNNLLTT ARVNYQPYGIDFLTGPTGRFCNGRTTVDILAQLLGFENLIPPFATSNKGPDILKGLNYAS GAAGIRELYIYYSSTSGSELCIWRVVGIRIETGSQLISNYLITKLQPYALLPYLETLNDK YGARKVALVGLGLIGCTPNAISTFGTNGSACVDKLNSAAQMFNQKLVSLVDQLNANLRDA KFIYVNSFGMGSGDPAAAGFRVVNVGCCPVNNIGQCAAGQTPCQNRSEYVFWDGFHPTEA LNHITAIRTYTAFDPSDTYPMDISHLVQLSEYVLWDGFHPTEALNQITSRRTYIEFDPSD TYPLDISHLIQLMPTTILFMMVVVLVDPIHGAPQLPCFFIFGDSLADNGNNNNLLTTARV NYQPYGIDFLTGPTGRFCNGRTTVDILAQLLGFENLIPPFATSNKGPDILKGLNYASGAA GIRVETGSQLGGHISLDQQLLNHQVTAIRIASILGSNQSALQYLNKCLYSTLNNKYGARK VALVGLGLIGCTPNAISTFGTNGSACVDKLNSAAQMFNQKLVSLVDQLNANLRDAKFIYV NSFGMGSGDPAAAGFKVVNVGCCPVNNIGQCAAGQTPCQNRSEYVFWDGFHPTEAMNQIT AIRTYTAFDPSDTYPTDIRCCPVNNIGQCAAGQTPCQNRSEYVFWDGFHPTEAMNQITAI RTYTAFDPSDTYPMDISHLTLYSYGARKVALVGVAPIGNATEPFNEKLRALVDKLNTDLE DAQFIYVNASSVSRPAGTWLHFCASLFCCDP


| Top |