Cherry SNP DataBase

Gene information

Gene Pav_sc0001289.1_g070.1.mk
Chromosome name PAV_r1.0chr4
start 4420684
end 4429246
PAV_r1.0 name Pav_sc0001289.1
start 57738
end 66300
direction +
Annotation NR PREDICTED: alpha,alpha-trehalose-phosphate synthase
Sequence CDS ATGCCAGGAAACAATTATAACTGCAATCCTTCCACACCCAGAAGTAGATTGGAAAGGCTT CTCAGGGAAAGAGAGCTAAGGAGATCAAACCGCGTTTTGCATCCAACTGAAGATGGAAAC AGACAGGCAGAACTCTTAGGGAATGATAATTTTTTGACTGAGGGTGAAAATTTTGGTCTA TCTAGTGAGGAAGATTTTCCGGAAGGGGTTGCTGCGGCAAAAGCTTTTGCCGATGGATGT GAATGGAAAGAGGGACGGACTCCTAAGCAACGTTTATTGGTGGTGGCTAACAGGTTACCT GTCTCTGCAGTTAGGAAGGGTGAGGACTCATGGCAGCTTGAGATGAGTGTAGGTGGGCTA GTCAGTGCACTTTTAGGCGTGAAGGAGTTTGATGCAAGATGGATTGGTTGGGCTGGTGTA AATGTACCTGATAGTGTTGGACAAAAAGCACTGACTAAAGCTTTAGCTGAAAAGATTACA CTGTCATTACACAATAAAATTCTGTCAGTATTCTGTTGTGAAATGTGTTCTGTATGTTTC CATACCTATGATTATGCAAGGCATTTTGTTAGTGCTTGCACTCGTATTCTTGGTTTAGAG GGTACACCTGAAGGAGTAGAGGATCAAGGAAAGCTGACTCGTGTGGCTGCGGTATTTTCC AATTGGGATAGACTCAGATCGCTTCATTCGAGCTCTAGAACTCCCTCAAGTCCAGGAGCA CATGAAAGAACTGAAAGAAAGATTTGCTGGCAGAAAGATCAAAAGCTCACAAGCCAGGTT CATGAGATTGTTGGACGCATTAATGGGAGGTTTGGAACTCTTACTGCTGTTCCAATACAT CATCTGGATCGATCTCTTGACTTTCACGCATTATGTGCACTATACGCTGTTACTGATGTA GCCCTTGTTACATCTTTAAGGGATGGAATGAATCTTGTGAGCTATGAGTTTGTTGCTTGC CAAGCTTCCAAGAAAGGAGTTCTCATTCTAAGTGAGTTTGCAGGTGCAGCACAGTCACTT GGTGCAGGGGCTATATTAGTGAACCCGTGGAATGTCACAGAAGTAGCTGCTTCCATAGGT TATGCTTTAAATATGCCAGCTGATGAAAGAGAAAAGCGTCACCATCATAACTTCATGCAT GTAACAACTCACACGTCTCAGGAGTGGGCTGCAACCTTTGTAAGCGAACTCAATGACACA ATTGTTGAAGCTCAACTAAGGACGAGACAAGTTCCTCCTTTACTTCCAATCCAAGTAGCA GTTGATCGTTATTTGCAATCCAGCAATCGATTACTTATACTGGGATTCAATGCCACTTTG ACTGAACCAAAGGACACCCTCGGGAGAAGGGGTGGTCAAATTAGAGAAATGGAACTTAAA TTGCATCCAGATCTCAAGGAACCCTTGAAAAAGCTTTGTGATGACTCAAAGACAACAATT GTTGTCCTCAGCGGAAGTGACAGAAGCGTCTTGGATGATAACTTCGGTGACTACAACATG TGGCTGGCAGCAGAAAACGGGATGTTCCTACGTCTTACAATGGGAGAATGGATGACAACA ATGCCAGAAAATTTAAATATGGATTGGGTCGACAGCGTAAAGCATGTTTTTGAGTATTTT ACTGAGAGAACGCCGCGGTCTCATTTTGAGCTTCGTGAAACTTCACTTGTATGGAACTAC AAGTATGCAGACATTGAGTTTGGAAGGCTCCAAGCAAGAGATCTGCTGCAGCATCTGTGG ACAGGCCCAATCTCAAATGCATCTGTTGATGTCGTCCAAGGTGGTCGATCCGTGGAGGTC CGAGCAGTTGGTGTTACAAAGGGTGCAGCGATTGATCGTATTTTAGGAGAAATAGTCCAT AACAAAGGCATGAAAGCACCAATTGATTATGTCCTGTGTATTGGGCACTTCCTACCAAAG GACGAAGATGTCTACACATTTTTTGAACCAGAGCTTCCTTCTGAGGCACCACCAACTGTT CCTAGACCTATGGCAGCCAATCCTGCCATGACATCTGTGCCAAGGATTTCCACAACTAAA AGTGGTTCCAGAGCAGCTCGCCTTAAGAAACAACGGTCCTTGTCAACTTTGGAAAAGAGA GCTACGGTTCATGGAATTGGGAATGCTTGGAGGCCAACACTAATGCGTGATAAAATGTCT CTGCATGAAGGTTCTTCAGTGCTTGACCTCAAAGGTGACAATTACTTCTCTTGTGCTGTT GGACGAAAGAGATCGAGTGCACGATATCTCCTTGGATCATCGGATGACATTGTCACTCTC TTGAAAGAGCTGGCTGAGGGTTCATAA
PEP MPGNNYNCNPSTPRSRLERLLRERELRRSNRVLHPTEDGNRQAELLGNDNFLTEGENFGL SSEEDFPEGVAAAKAFADGCEWKEGRTPKQRLLVVANRLPVSAVRKGEDSWQLEMSVGGL VSALLGVKEFDARWIGWAGVNVPDSVGQKALTKALAEKITLSLHNKILSVFCCEMCSVCF HTYDYARHFVSACTRILGLEGTPEGVEDQGKLTRVAAVFSNWDRLRSLHSSSRTPSSPGA HERTERKICWQKDQKLTSQVHEIVGRINGRFGTLTAVPIHHLDRSLDFHALCALYAVTDV ALVTSLRDGMNLVSYEFVACQASKKGVLILSEFAGAAQSLGAGAILVNPWNVTEVAASIG YALNMPADEREKRHHHNFMHVTTHTSQEWAATFVSELNDTIVEAQLRTRQVPPLLPIQVA VDRYLQSSNRLLILGFNATLTEPKDTLGRRGGQIREMELKLHPDLKEPLKKLCDDSKTTI VVLSGSDRSVLDDNFGDYNMWLAAENGMFLRLTMGEWMTTMPENLNMDWVDSVKHVFEYF TERTPRSHFELRETSLVWNYKYADIEFGRLQARDLLQHLWTGPISNASVDVVQGGRSVEV RAVGVTKGAAIDRILGEIVHNKGMKAPIDYVLCIGHFLPKDEDVYTFFEPELPSEAPPTV PRPMAANPAMTSVPRISTTKSGSRAARLKKQRSLSTLEKRATVHGIGNAWRPTLMRDKMS LHEGSSVLDLKGDNYFSCAVGRKRSSARYLLGSSDDIVTLLKELAEGS


| Top |