Cherry SNP DataBase

Gene information

Gene Pav_sc0001289.1_g140.1.mk
Chromosome name PAV_r1.0chr4
start 4461117
end 4463476
PAV_r1.0 name Pav_sc0001289.1
start 98171
end 100530
direction +
Annotation NR PREDICTED: bidirectional sugar transporter SWEET2a-like
Sequence CDS ATGTTGCCAACTCGGTTGTCTTCTGTTTACTTAGGTTTCAGTACAGCAGCCGGCATTGCT GGGAATATCTTTGCCTTCGTGTTGTTTGTGTCACCATTGCCAACATTCAAGAGAATCATC AGAAACAAGTCAACAGAACAATTCTCTGGATTGCCTTACATATATGCCCTTTTGAATTGC TTGATATGTCTTTGGTATGCCATGCCTGTAGTGAAGACTGGTATTATATTGGTGGCTACA GTTAATTCATTTGGGGCTGTTTTCCAGTTAGTCTACTTGAGCATTTTCATTACGTACGCT GAAAGAGCAACTAAGCTGAGGATGTTGGGATTTATAGGGGCAGTTGCTGTTATATTCGCG TTCGTTGTCTTCGTGAGCTTAGGACTTTTAGAGTATGATGAGAGGCAAACGTTCGTTGGA TATTTGAGTGTTGCTTCACTTATTTCAATGTTTGCTTCGCCGCTGTTTATCATAAAACTG GTGATCAAAACAAGGAGTGTTGAATTCATGCCATTTAATCTCTCTTTTGCAACTTTCTTG ATGAGTCTCTCGTTCTCTGCCTATGGAGTATTCAAGGAAGACCCCTTCCTTTATATCCCA AATGGTATTGGAACAATTTTAGGCCTTGTCCAGTTGGCTCTCTACTCCTACTATAGCAAC ATATCTGGAGAAGACTCGAGAGAACCATTGATAGTTTCATATGCGTGA
PEP MLPTRLSSVYLGFSTAAGIAGNIFAFVLFVSPLPTFKRIIRNKSTEQFSGLPYIYALLNC LICLWYAMPVVKTGIILVATVNSFGAVFQLVYLSIFITYAERATKLRMLGFIGAVAVIFA FVVFVSLGLLEYDERQTFVGYLSVASLISMFASPLFIIKLVIKTRSVEFMPFNLSFATFL MSLSFSAYGVFKEDPFLYIPNGIGTILGLVQLALYSYYSNISGEDSREPLIVSYA


| Top |