Cherry SNP DataBase

Gene information

Gene Pav_sc0001309.1_g1320.1.mk
Chromosome name PAV_r1.0chr5
start 12837058
end 12839968
PAV_r1.0 name Pav_sc0001309.1
start 668050
end 670960
direction +
Annotation NR PREDICTED: probable apyrase 7
Sequence CDS ATGGAACCCAAATCTCCTTCAAAACTTAAGCTCTCAATCACGGGAATTGCTCAATACAAG CAGGCGTTGAGAACGAGTTTTATGGTTACAGTTATAATACTCATATTATTTGGTGCCTAT TTTGCGTTTATACCTGGGAAAAGCCATAGTGTATCTAAAGGACCATATTATACGGTGGTT GTTGATTGTGGAAGCACGGGGACCCGAGTAAATGTGTACAAGTGGCTGGCAAGGGATGTA AGTAGTAAGGAATTGCCGATTTTGTTGTATTCTTATCCCAACAATTCAACTGATGGAATT CTTTGGAAAAGTTGTAAGTACCACTGTCTGCAAACTGAGCCTGGTTTGGATAAATCTGTC GGAAACTTATCGGGAGTAAGAGCATCTTTGGAACCATTAATTACGTTGGCAGAACATAAG GTTCCTTCTGAAAAACGCAGAGACACTCCCATTTTTGTTCTAGCTACTGCTGGACTAAGG AGATTGGCAATGAAGGATGCTAGGCGGGTATTGAATGACATAGAAGCTGTTGTAAAAGAA CATACTTTTTTGTATAAAAAGAGTTGGATACGGGTGTTGAGTGGCCAAGAAGAAGCTTAT TATGGTTGGGTGGCTCTAAATTATAAAATGGGTAGCTTTGGGAATCATTCAAGGTCACCG ACTTTGGGACTTCTTGACTTAGGAGGTTCATCATTGCAGATTGTCGTGGAAGTTGATGAT ACAAGAGAAGATGCAAACTTAGTGAGATCAAAATTTGGTTTTGTCGAACGTGATATTTTA GCTTACTCATTGTCGGAATTTGGATTGAATGAAGCATTTGATAGGACGGTTGTTATGCTC AGCCATATGGAACAACTCAGAGAAAGTGCTTCTGGTATAGTAGAGATCAGACATCCTTGT CTTCATACTGACACTGTGCAAAACTATACCTGCTATGGTTGCTCCCAACAAAACGCTCCT GATCAGAAAAATGTGACCAGTCAAGTGCAAGAAACTAAATTTCCTTGTGTGTATCTGGTT GGAGCGCCAAATTGGGAGCAATGCAGAAGACTTGCTAGGGTTGCTGCTATCAATTCAAGC ACAGCTGACACAGACCATAGAGCAAGGTCATGTTCTGATAATGGGAGTGAAATGATAAAT TTGACTGCTTTTGCTCACCCCAAAGCCCGCTTTCATGCACTATCTGGATTTTTTGCTGTT TATGACAAGTTGAATTTGAGCGCAAGAGCTACCTTGATGAAGATTTGGGAGAAAGGCCAG CAAGTATGCTCCAGATCATGGTCTGACCTAAGCAGTAATTCACAGAATGCATATTTTGCT TGGCAATATTGTTTTCGTGTACCTTATGTGGCATCGCTCATTGATGATGCCCTGTGTCTT GGTGACAAAGAGATCATTTTTGGTCCTGCGGATGTTACCTGGACATTAGGAGCTGCATTG GTCGAAGGAGAATATTTATGGTCAAGTCCTACTAGATCTCAAATTAGCATTTTAGCCCTA AATATGGAGGTTATATCCTCTCCCATTTTTGTACTTGTTTTACTTCTTAGTATTCTATTG ATTGTATATTGTTGTCAAGTCAAGCTCCCCATGATAGGCAGGAAGAGCGCAGTAAGAGGA CAGAAGATGATAGATTAG
PEP MEPKSPSKLKLSITGIAQYKQALRTSFMVTVIILILFGAYFAFIPGKSHSVSKGPYYTVV VDCGSTGTRVNVYKWLARDVSSKELPILLYSYPNNSTDGILWKSCKYHCLQTEPGLDKSV GNLSGVRASLEPLITLAEHKVPSEKRRDTPIFVLATAGLRRLAMKDARRVLNDIEAVVKE HTFLYKKSWIRVLSGQEEAYYGWVALNYKMGSFGNHSRSPTLGLLDLGGSSLQIVVEVDD TREDANLVRSKFGFVERDILAYSLSEFGLNEAFDRTVVMLSHMEQLRESASGIVEIRHPC LHTDTVQNYTCYGCSQQNAPDQKNVTSQVQETKFPCVYLVGAPNWEQCRRLARVAAINSS TADTDHRARSCSDNGSEMINLTAFAHPKARFHALSGFFAVYDKLNLSARATLMKIWEKGQ QVCSRSWSDLSSNSQNAYFAWQYCFRVPYVASLIDDALCLGDKEIIFGPADVTWTLGAAL VEGEYLWSSPTRSQISILALNMEVISSPIFVLVLLLSILLIVYCCQVKLPMIGRKSAVRG QKMID


| Top |