Cherry SNP DataBase

Gene information

Gene Pav_sc0001309.1_g1420.1.mk
Chromosome name PAV_r1.0chr5
start 12785893
end 12789259
PAV_r1.0 name Pav_sc0001309.1
start 718759
end 722125
direction -
Annotation NR hypothetical protein PRUPE_ppa005042mg
Sequence CDS ATGGAGGGTCCGAGTCCTTGTGCCACAGAACCCGGCTCCCAAGACTCCCACAACGCCTTT GTTTGGGACGAAAGCTCTCAGCTTTATTTCCATGCCGGTAGCGGATTTTACCATGACCCG ACCGCTGGTTGGTACTATAGCACTCGGGACGGTCTTTACTACAAATTCGAAGATGGAAAC TACGTGCTTCTTCCCTCTCACCAGGCTGATAATTTGGAAACATGTGAAACCCAAGTGACT GCTTCTGAGAATCCCATTCAAAGAGAGCTTTTTGCACATGAAAGTGAATGCATAGAAACT GTTCCTCAGGAACCCATTGGAATTTCAGGCACCACAGAGTGCTGCAGTAGCAGTGATGTA CCTGAAAATCCCCCTCCCACCTCAGAATGGTTAGAAGATACGCTTATTGATCTTTATTTG TCTGGTTATTCCAACTTAGAAGCCAATGCTGCTGATGATATGACAGTCTTTCCCGAAACA GATGTTGAGTTTGGATCCAATGGGAATAGAGATAGTCACGAGCTCAATGAAGGCGAATTG ATTCTGGATGACCATGATGCTGCAATTAAATCAAGTGAAAATGTTTCTGATGAAGGTGCT TCATTGGATGAAGAGAACTGGCGAGCTCAATATGGTCAGGTCATTCAATCTGAAGAAGTT TCAATCCCGGAGTCCTCACTTGTAAGTTTATGGGACTGGGAAATTCTCACAAAGCCCAAA AAGGATGGAAAAGGTGAGGTAGCGAGGCTTGTCGGGAGATTAGTGAGGCGGTCTGCTAAG CTTCATCCATCTATGCCTTCTGGTGGTGGTCTTCTAAAAACTGCTCCAATATGTGAAGTA CATCTTGATCTGGTACGAGTTATAACAGTCAACACACAAATTCAGGCCCTCTCTAAATCC AGTGCAAACAGTGAATCAATAACTGCAGATGGAGTGGCAGTTAGCAAGGATTCATCTTTG TTGCCAGGCCAAATATATGAAAAGCATGAAAGCTATACATATAGGGATAGAGCTGCTGAT AGAAGAGCCTTGCACGGTGGTTTCGGTGTGGGTCCAGGACAAAAGAATTCACTAATTGGT GATAGTGATTCGCCGCCAGGCTCTACAGAAGAAGCTGCAGCAGAGGCCTTGAACATGTCA TTTGGAGTTGGTAGTTATGCCAGAAAACTTTTAGAAAACATGGGCTGGAAGGAGGGAGAG GCACTTGGCAAAAGTACAAGGGGATTAGTTGAACCTATTCAAGCACACAGCAACATTGGT AATGCTGGATTAGGGTGGCCTCATGGAAGATTTAAGCATCCCTGA
PEP MEGPSPCATEPGSQDSHNAFVWDESSQLYFHAGSGFYHDPTAGWYYSTRDGLYYKFEDGN YVLLPSHQADNLETCETQVTASENPIQRELFAHESECIETVPQEPIGISGTTECCSSSDV PENPPPTSEWLEDTLIDLYLSGYSNLEANAADDMTVFPETDVEFGSNGNRDSHELNEGEL ILDDHDAAIKSSENVSDEGASLDEENWRAQYGQVIQSEEVSIPESSLVSLWDWEILTKPK KDGKGEVARLVGRLVRRSAKLHPSMPSGGGLLKTAPICEVHLDLVRVITVNTQIQALSKS SANSESITADGVAVSKDSSLLPGQIYEKHESYTYRDRAADRRALHGGFGVGPGQKNSLIG DSDSPPGSTEEAAAEALNMSFGVGSYARKLLENMGWKEGEALGKSTRGLVEPIQAHSNIG NAGLGWPHGRFKHP


| Top |