Cherry SNP DataBase

Gene information

Gene Pav_sc0001309.1_g250.1.mk
Chromosome name PAV_r1.0chr5
start 13407510
end 13411046
PAV_r1.0 name Pav_sc0001309.1
start 96972
end 100508
direction -
Annotation NR PREDICTED: betaine aldehyde dehydrogenase 1, chloroplastic-like isoform X1
Sequence CDS ATGGCGATCCAAATACCGAACCGGCAGTTATTCATCGACGGCGAGTGGAGAGAACCAGCA CTCAAGAAACGCATCCCCATCATCAACCCTGCCACTGAAGAAACCATTGGGGATATTCCT GCAGCAACTGCTGAAGATGTGGAGATTGCAGTGGAGGCTGCTCGAAAAGCCCTGGCCAGG AACAAGGGTAGAGATTGGTTCTCCGCGTCTGGGGCCCTTCGTGCCAAGTATTTGCGTGCT ATTGCTTCTAAGATAAAAGAGAGAAAACCTGAGCTAGCCAAACTTGAAGCAATTGATAGT GGAAAACCACTGGATGAAACGACCTCTGACATAGATGAGGTTGCCGGGTGTTTCGAATAC TATGCAGGCCTTGCTGAAGGTTTGGATGCAAAGCAAAAGGCTCCTATTTCTCTTCCTACG GAGAATTTTAAAACTCACGTTCTTCAGGAACCGATTGGGGTTGTTGGGTTGATTACAGCA TGGAACTACCCTTTATTGATGGCTGCATGGAAAGTAGCTCCTGCCTTGGCTGCTGGGTGT GCTGCTATACTGAAACCATCTGAGTTGGCATCTATAACTTGTTTGGAGCTAGCTGAGGTG TGTATAAAGGTCGGTCTTCCTCCGGGTGTCCTCAATATTCTGACTGGACTGGGCCAGGAA GCTGGCGCCCCTTTGGCATCTCATCCCCATGTTGATAAGGCTGTAATCGCAAAATTGATT AATATCCGACAGGTTGCATTTACCGGAAGTACTATCACTGGGAGCAAGATTATGGCAGCT GCAGCTCAATTGGTCAAGCCTGTTTCACTGGAGCTTGGAGGAAAAAGCCCAATTGTTGTT TTTGAGGATGTTGATATTGAGAAGGCTGTGGAATGGACCTGCTTTGGTATCTTTTTGACA AATGGTCAGATTTGCAGCGCAACCTCCCGTCTTATAGTGCATGAAAGAATTGCGGCAGAG TTTATGGACAGGCTTTTGAAATGGTGCAAAAACATCAAGGTTTCAGATCCTATGGATGAA GGTTGCAGGCTTGGTCCTGTTGTGAGTAGAGGGCAGTACGAGAAAATATTGAAGTTCATC TCAACAGCTAAAAGTGAAGGAGCAAAAGTTGCGTTTGGTGGGGGTCATCCTGAGCATCTA AAGAAAGGGTTCTTCATTGAACCAACCATCATAACCGACGTAACAGCCTCGATGCAAATT TGGAGAGAAGAAGTATTTGGACCTGTTCTTTGTGTCAAAACATTTGGTTCAGAAGAGGAA GCTCTTGAATTAGCAAATGACACCTATTATGGCCTAGGCGCTGCTGTGATGTCAAAAGAT TCAGAAAGGTGTGAGCGCTTTTCTAAGGCCCTTCAGGCAGGAATTGTGTGGATCAATTGC TCACAACCATCCTTCATTCAGGCTCCATGGGGAGGCATTAAAAGAAGCGGTTTCGGCCGC GAATTAGGAGAATGGGGACTTGATCTCTACTTGAGCGTGAAACAGGTGACTCAGTATGTA TCTGATCAACCTTGGGGTTGGTTCAAGTCACCTTCAAAGCCATGA
PEP MAIQIPNRQLFIDGEWREPALKKRIPIINPATEETIGDIPAATAEDVEIAVEAARKALAR NKGRDWFSASGALRAKYLRAIASKIKERKPELAKLEAIDSGKPLDETTSDIDEVAGCFEY YAGLAEGLDAKQKAPISLPTENFKTHVLQEPIGVVGLITAWNYPLLMAAWKVAPALAAGC AAILKPSELASITCLELAEVCIKVGLPPGVLNILTGLGQEAGAPLASHPHVDKAVIAKLI NIRQVAFTGSTITGSKIMAAAAQLVKPVSLELGGKSPIVVFEDVDIEKAVEWTCFGIFLT NGQICSATSRLIVHERIAAEFMDRLLKWCKNIKVSDPMDEGCRLGPVVSRGQYEKILKFI STAKSEGAKVAFGGGHPEHLKKGFFIEPTIITDVTASMQIWREEVFGPVLCVKTFGSEEE ALELANDTYYGLGAAVMSKDSERCERFSKALQAGIVWINCSQPSFIQAPWGGIKRSGFGR ELGEWGLDLYLSVKQVTQYVSDQPWGWFKSPSKP


| Top |