Cherry SNP DataBase

Gene information

Gene Pav_sc0001309.1_g260.1.mk
Chromosome name PAV_r1.0chr5
start 13406424
end 13406666
PAV_r1.0 name Pav_sc0001309.1
start 101352
end 101594
direction -
Annotation NR hypothetical protein PRUPE_ppa014245mg
Sequence CDS ATGAACGGAGACAAAGCTAACAATTACGAGACCTCCTGGGCCGATCAGTGGGATTACAAC AGCAACTCCTCCTACCCCGTCGTGGTCAAAGGCGGCAATGGCGGAACCGCCGCCAAGTGC AAGCAAAAGGTCGGCGAAGGCCTCGTCAAAACAAAGGCGGTGGCTTCCACCAGCGCTAAA AAGGTCAAGGAAGGGGCCTCCACTGGGTTTCAATGGATCAAACAAAAGTGCCAGAAGAAA TAG
PEP MNGDKANNYETSWADQWDYNSNSSYPVVVKGGNGGTAAKCKQKVGEGLVKTKAVASTSAK KVKEGASTGFQWIKQKCQKK


| Top |