Cherry SNP DataBase

Gene information

Gene Pav_sc0001323.1_g1110.1.mk
Chromosome name PAV_r1.0chr1
start 40572501
end 40589744
PAV_r1.0 name Pav_sc0001323.1
start 675276
end 692519
direction -
Annotation NR PREDICTED: phosphatidylserine decarboxylase proenzyme 3-like
Sequence CDS ATGTTTAAAGCTGCTGACAAGAACGGGGATGGTGTTGTTAGCATGGATGAGTTGGCTGCC CTTCTTGCCATTCAACAAGAAAAGGAACCACTAATGAATTGCTGTCCTGTTTGTGGTGAG ACTCTTGAAGTTTCTGATAAGCTGAACTACATGATACATTTGACCCTATGTTTCGATGAA GGAACTGGAAAACAGGTCATGACTGGAGGATTTTTGACTGATAAACAGGCTTCTTATGGG TGGATGTTTAAACTCAGTGAATGGGCCCATGTTTCATCTTATGACGTTGGTTTAAATTCT GGTTCGAGTGCTCACCATATTGTGGTATTTGATCGGAGGACAAAGAGACTTGTGGAAGAA CTAATAGATGAAAAGATTGTTTTGTCAATGAGAGCCATTTACCAGTCAAAACTAGGGCTT GGCCTCCTGGATACAGGGGCAAAGGATATCTTGCAGAGCCTCTCTGAAAAGCAGGGGAAG AAAATGAACTCAGTGGAATCTGCTAAAGATATACCGAAATTTGTCGAGTTTTTTAAGGAT CAAATCAATTTGGCTGAAGTCAAGCACCCTTTGGAACATTTTAAGACATTTAATGAATTT TTTGTGAGAGAGTTAAAGCCTGGAGCAAGACCTATTGCCTACATGGAACGTGATGATGTT GCCATATCTGCTGCAGATAGCCGTCTTATGGCATTCAAATCCATTGATGAAAGTCTGAGA TTTTGGATTAAGGGTCGAAAATTTTCAATTCAGGGGCTTTTGGGGAAAGATCAATGTTCC AATGCTTTCATCAATGGAACATTGGTAATATTTCGTTTGGCACCACAGGATTATCATCGT TTCCATTTTCCTGTTTCTGGAACTATTCAGCAGTTTGTACATATACCTGGATGCTTATAT ACGGTTAACCCCATAGCTGTGAATAGCAAGTATTGTAATGTTTTCACTGAGAATAAGCGA GTAGTATCAATTATATCAACTGCAGAATTTGGAAAGGTGGCTTTTGTTGCCATTGGTGCA ACTATGGTTGGCAGCATTACCTTTTCAAAGAAGGAGGGTGACCATGTTAAGAAAGGAGAA GAGTTTGGCTATTTCTCATTTGGTGGAAGCACTGTAATCTGCGTCTTTGAAAAGGATGCT ATTGAGATAGATGAGGACCTCCTAGCAAATAGTGCCAGATCACTAGAGACCTTGGTTACT GTTGGGATGAAGTTAGGTGTCTCCAAGAAACTAGCTAATATTGGGTTGCCAAACATAGAA AAATGTGTGTTGCAAGATTGA
PEP MFKAADKNGDGVVSMDELAALLAIQQEKEPLMNCCPVCGETLEVSDKLNYMIHLTLCFDE GTGKQVMTGGFLTDKQASYGWMFKLSEWAHVSSYDVGLNSGSSAHHIVVFDRRTKRLVEE LIDEKIVLSMRAIYQSKLGLGLLDTGAKDILQSLSEKQGKKMNSVESAKDIPKFVEFFKD QINLAEVKHPLEHFKTFNEFFVRELKPGARPIAYMERDDVAISAADSRLMAFKSIDESLR FWIKGRKFSIQGLLGKDQCSNAFINGTLVIFRLAPQDYHRFHFPVSGTIQQFVHIPGCLY TVNPIAVNSKYCNVFTENKRVVSIISTAEFGKVAFVAIGATMVGSITFSKKEGDHVKKGE EFGYFSFGGSTVICVFEKDAIEIDEDLLANSARSLETLVTVGMKLGVSKKLANIGLPNIE KCVLQD


| Top |