Cherry SNP DataBase

Gene information

Gene Pav_sc0001323.1_g980.1.mk
Chromosome name PAV_r1.0chr1
start 40677027
end 40681529
PAV_r1.0 name Pav_sc0001323.1
start 583491
end 587993
direction +
Annotation NR PREDICTED: tubulin gamma-1 chain
Sequence CDS ATGCCGAGAGAGATCATCACATTGCAGGTCGGACAATGCGGGAATCAGATCGGCATGGAG TTCTGGAAACAACTCTGCCTCGAGCATGGAATCAGCAAAGAAGGAATTCTCGAGGACTTT GCCACTCAGGGTGGAGATCGGAAAGATGTGTTTTTCTATCAAGCTGATGATCAGCACTAC ATACCGCGAGCTTTGCTGATTGACCTGGAGCCAAGAGTGATTAATGGTATTCAAAACAGT GAATATCGAAATCTGTACAATCATGAAAACATCTTTGTTTCAGATCATGGAGGTGGCGCA GGAAATAATTGGGCCAGTGGATATGATCAGGGAAAGGGTGTTGAAGAGGCTATAATGGAC ATGATTGATAGAGAAGCTGATGGAAGTGATAGTCTTGAAGGATTTGTTCTGTGCCATTCA ATTGCTGGAGGAACAGGCTCAGGCATGGGTTCCTATCTACTGGAGACTTTGAATGATCGA TACAGCAAAAAACTGGTTCAGACATACAGTGTATTTCCTAACCAGATGGAAACAAGTGAT GTGGTGGTCCAGCCCTATAACTCACTTTTGACGCTTAAACGTCTAACGCTTAATGCTGAT TGTGTTGTGGTCCTTGATAACACTGCATTGAATAGAATTGCTGTTGAGCGCCTTCATTTA ACAAATCCAACCTTTGCTCAAACAAATTCTTTGGTTTCTACTGTAATGTCTGCCAGCACA ACCACTCTGAGATATCCAGGATACATGAACAATGACTTGGTTGGTCTTCTTGCATCTTTA ATTCCAACACCAAGATGCCATTTTCTAATGACAGGGTATACACCTCTCACAGTTGAGCGC CAGGCTAATGTAATTCGCAAAACCACTGTACTTGATGTTATGAGAAGACTTCTGCAGACA AAAAATATAATGGTTTCCTCATATGCTCGAACAAAAGAAGCTAGTCAAGCGAAGTACATA TCAATATTAAACATCATTCAAGGAGAAGTTGACCCTACTCAGGTTCATGAAAGTTTGCAG AGGATACGTGAAAGAAAGCTTGTTAACTTTATTGAATGGGGCCCTGCAAGCATTCAGGTT GCTTTGTCTAGAAAGTCTCCATATGTGCAAACGGCCCATAGGGTCAGTGGCCTTATGCTG GCAAGCCATACTAGTATTCGCCACCTTTTCAGTAAGTGTTTGAGCCAGTATTTGATGCTA AGAAAGAAGCAAGCCTTTCTTGACAACTATCGGAAGTTCCCAATGTTTGCATATGACATA AAACGTGGACAGGAGAATGACCTTTCGGAATTTGACGAATCAAGAGAGATACTTCAGAGT TTGGTTGAGGAATATAAGGCCTGTGAGTCCCCAGATTACATCAAATGGGGAATGGAGGAT CCAGACCAAATTCTTACAGGAGAAGGCAATGCAGCAGGAACAGTGGATCCAAAATTGGCA GATTGGAAGACTGTTGCAGGACAAGTCCTGGCACCAGGAAGTACATTGGATGGAGCATTG TAA
PEP MPREIITLQVGQCGNQIGMEFWKQLCLEHGISKEGILEDFATQGGDRKDVFFYQADDQHY IPRALLIDLEPRVINGIQNSEYRNLYNHENIFVSDHGGGAGNNWASGYDQGKGVEEAIMD MIDREADGSDSLEGFVLCHSIAGGTGSGMGSYLLETLNDRYSKKLVQTYSVFPNQMETSD VVVQPYNSLLTLKRLTLNADCVVVLDNTALNRIAVERLHLTNPTFAQTNSLVSTVMSAST TTLRYPGYMNNDLVGLLASLIPTPRCHFLMTGYTPLTVERQANVIRKTTVLDVMRRLLQT KNIMVSSYARTKEASQAKYISILNIIQGEVDPTQVHESLQRIRERKLVNFIEWGPASIQV ALSRKSPYVQTAHRVSGLMLASHTSIRHLFSKCLSQYLMLRKKQAFLDNYRKFPMFAYDI KRGQENDLSEFDESREILQSLVEEYKACESPDYIKWGMEDPDQILTGEGNAAGTVDPKLA DWKTVAGQVLAPGSTLDGAL


| Top |