Cherry SNP DataBase

Gene information

Gene Pav_sc0001335.1_g110.1.mk
Chromosome name PAV_r1.0chr2
start 24279885
end 24291083
PAV_r1.0 name Pav_sc0001335.1
start 28841
end 40039
direction -
Annotation NR PREDICTED: LOW QUALITY PROTEIN: glutamate synthase
Sequence CDS ATGCGTGTCATTGGCCACAATGGAGAAATCAACACCCTTAAAGGAAATGTTAACTGGATG AAGGCGCGCGAGGGACTGCTTAAGTGTAAGGAACTTGGTCTATCAAGAAATGAGTTAAAG AAGCTGTTACCTATTGTGGATGCCAGTTCTTCCGATTCAGGAGCTTTTGATGGTGTCCTT GAGTTTCTGGTTCAAGCTGGCAGAAGCCTTCCTGAAGCTATGATGATGATGATTCCTGAA GCATGGCAAAATGACAAGAACATGGATCCTCATAGGAAAGCGCTGTATGAATATTTCTCA TCTCTCATGGAGCCATGGGATGGGCCAGCTCTTATATCATTTACTGATGGTCGCTATTTG GGAGCTACACTGGATCGTAATGGACTTCGGCCTGGTCGATTTTATGTTACCCACAGTGGA CGAGTTATTATGGCCAGTGAAGTTGGTGTAGTAGACATTCCTCCAGAAGATGTCAGTAGG AAAGGAAGACTTAATCCTGGAATGATGCTTTTGGTGGATTTTGAGAATCATATTGTTGTA GATGATGAAGCTTTGAAGCAGCAATACTCGTTGGCAAGGCCATACAGGGAGTGGCTTGAA AGGCAAAAGATTGAGCTCAAGGACATAGTAGCTTCTGTTCAAGAATCTGACAGGGTCCCT CCATCCATTGCGGGAGTTATTCCTGCATCTACTGATGATGAAAACATGGAAAACATGGGA ATCCATGGTTTATTGGCACCATTGAAAGCTTTTGGCTATACAGTTGAATCCCTGGAAATG TTGTTGCTTCCCATGGCAAAAGATGGTGTAGAGGCTCTTGGGTCAATGGGAAATGATACC CCATTGGCTGTTATGTCTAACAGAGAAAAGCTTACATTTGAGTATTTCAAGCAAATGTTT GCTCAAGTAACAAACCCTCCAATTGATCCCATCCGAGAGAAGGTAGTCACTTCTATGGAA TGCATGATTGGTCCGGAGGGTGATCTGACTGAAACCACTGAAGAACAATGTCATCGTCTC TCACTCAAAGGTTCTCTTTTAACCATAGAAGAAATGGAAGCAATAAAAAAAATGAACTAT AGAGGTTGGCGTTGCAAAGTTCTTGATATAACTTATTCCAAGGAACGTGGTAGGGAAGGA TTGGAGGAGACCTTGGATAGAATCTGTGCTGAAGCACATGAAGCAATTAAGAAGGGATAT ACCACACTCGTTCTTTCAGACAGAGCCTTCTCCCCAAAGCGTGTTGCTGTAAGCTCCCTT TTAGCTGTTGGTTCTGTTCATCAACACCTAGTTAAAAATCTTGAACGCACAAGAGTAGGG TTGATAATTGAATCTGCTGAGCCACGTGAAGTACACCATTTCTGTACACTAGTTGGTTTT GGTGCAGATGCTATCTGCCCATACTTGGCTATAGAAGCCATTTGGAGACTGCAGGTTGAC GGAAAGATCCCACCAAAAGCTAATGGTGTAATATACTCAAAGGATGAACTGGTTAAAAAG TACTTCAAAGCAAGCAACTATGGAATGATGAAGGTTCTTGCCAAGATGGGGATATCCACT TTAGCCTCTTACAAGGGTGCACAGATTTTTGAAGCTTTGGGTCTTTCATCAGAAGTAATT GAGAGGTGCTTTGCAGGAACCCCTAGTAGAGTTGAGGGTGCAACATTTGAGATGCTTGCT CGCGATGAACTTCATATGCACGAGTTGGCATTTCCATCTCGAACTTTTCCTCCAGGAAGT GCAGAAGCAGTTGCACTGCCAAATCCTGGGGATTATCATTGGAGAAAAGGTGGTGAGGTT CACCTAAATGATCCCTTCGCTATTTCAAAACTTCAAGAGGCTGCTAGAACTAACAGTGTG GCTGCATATAAAGAATACTCGAAGTTCATTCATGAATTAAACAAAGCCTGCAATCTCCGG GGTCTTCTGAAATTTAAAAGCACAGAGCAGAAGATTCACTTGGATGAAGTGGAACCTGCC AGTGAGATTGTAAAACGGTTCTGCACTGGTGCTATGAGTTATGGATCAATATCATTGGAG GCACACACCACACTGGCCATGGCTATGAACAGAATTGGAGGAAAGTCAAATACAGGTGAG GGAGGTGAGCAGCCATCTCGTATGGAGCCACTTCCAGATGGTTCAAGAAACCCAAAGAGG AGTGCAATTAAGCAGGTTGCTAGTGGCAGATTTGGAGTTTCAAGTTACTATCTTACTAAT GCTGATGAACTGCAGATAAAAATGGCTCAGGGGGCCAAGCCTGGTGAAGGAGGTGAGCTT CCTGGGCACAAGGTTATTGGAGACATTGCTGTTACAAGGAATTCTACTGCTGGTGTGGGT CTCATCAGTCCACCTCCTCATCATGATATCTACTCGATTGAAGACCTTGCTCAATTAATT CATGATCTTAAGAATGCTAACCCGGCAGCTCGAATTAGCGTAAAGTTAGTATCTGAAGTA GGTGTGGGAGTAGTTGCTAGTGGAGTTGTGAAGGGGCATGCTGACCATGTGTTAATCTCT GGACATGATGGAGGCACAGGGGCCTCTAGATGGACGGGTATTAAGAATGCTGGGCTTCCA TGGGAACTTGGTTTGGCTGAGACACATCAAACCTTGGTTGCTAATGATCTTCGCGGTCGC ACAACTCTTCAGACAGATGGCCAACTAAAAACTGGAAGAGATGTTGCCATAGCCGCACTT CTTGGTGCAGAAGAGTTTGGTTTCAGCACAGCACCCCTCATAACTCTTGGCTGCATTATG ATGCGGAAGTGCCATAAGAATACCTGTCCTGTTGGCATTGCAACCCAAGATCCAGTACTT CGTGAGAAGTTTGCAGGAGAACCAGAACATGTCATTAATTTTTTCTTTATGGTAGCAGAA GAATTGAGAGAAATAATGTCACAGCTTGGTTTCCGTACTTTAAATGAGATGGTTGGTCGT TCAGATATGCTTGAAGTCGATAAAGAAGTGACTAGAAACAATGAAAAGCTTGATAACATT GATCTATCCTTATTACTTAGACCTGCAGCAGACCTTCGGCCTGACGCTGCACAATATTGT GTCCAGAAACAAGATCATGGTTTGGACATGGCTCTTGACCACAAACTAATTTCTCTGTCC AAGGCTGCTATTGAAAAGTCTCTTCCTGTATACTTTGAAACAACTATTTGCAATGTGAAT CGTGCTGTTGGGACAATGCTTAGCCATGAGGTGACCAAACGTTACAACAGGGAAGGGCTT CCTGCTGACACTATCCATATAAAATTCAATGGAAGTGCAGGACAAAGTCTTGGAGCATTC CTGTGCCCGGGTATCATTCTTGAGCTTGAAGGTGACAGCAATGATTATGTTGGAAAAGGA TTGTCAGGTGGAAAGATTGTAGTTTATCCTCCCAAGAAAAGCAAGTTTGATCCGAAAGAA AATATTGTGATCGGTAATGTTGCTCTTTATGGTGCAACTAGTGGAGAGGCATACTTCAAT GGAATGGCAGCAGAAAGATTCTGTGTTCGCAATTCTGGGGCTAGGGCAGTTGTTGAAGGT GTTGGGGATCATGGTTGTGAATACATGACGGGTGGCACTGTTGTGGTGCTTGGGAAAACT GGCAGGAACTTTGCTGCTGGTATGAGTGGTGGTATTGCCTACATTCTTGATGTGGATGGA CAATTTCGGTCCCGATGCAATCTCGAGCTTGTAGATCTTGATAAACTTGAAGAAGAAGAT GTGATGACCCTTAAAATGATGATACAGCAGCATCAACGGCACACAAACAGCTTGCTGGCC AGTCAAGTACTGGCTGATTTTGGCAATCTTTTGCCTAAGTTTATCAAGGTTATCCCAAGA GAGTACAAGCGTGTTCTTGCAAATATGAAAGACGAAGCCTCCAAACAGGATGCTGTTGAT GAAGCTGAGCAAGACGAACCAGAGTTAATTGAGAAAGATGCTTTTGAAGAACTTAAGAAG TTGGCAGCTGCATCATCATTAAATGGGAAATCCAATCAGACGGTAGAAGATTCTGAAATA TTGAAGAGGCCTTCTCAGGTCAGCGATGCTGTCAAACATCGCGGTTTTATTTCTTATGAG CGTGAGGGCGTTCAATATAGGGATCCTAATGTTCGGATGAATGACTGGAAGGAAGTTATG GAGGAAACTAAACCTGGACCACTATTAAAGACTCAGTCAGCCCGTTGCATGGACTGTGGC ACTCCTTTCTGCCATCAGGAGAACTCTGGATGTCCTCTTGGTAACAAAATACCCGAGTTC AATGAGTTGGTGTACCAGAATAGGTGGCATGAAGCATTAGAGAGACTTCTAGAGACAAAT AACTTCCCTGAGTTTACCGGTCGAGTTTGCCCGGCACCTTGTGAAGGTTCCTGTGTTCTG GGTATTATTGAGAATCCTGTATCTATCAAAAGCATCGAATGTGCCATCATAGACAAGGCT TTTGAGGAAGGTTGGATGGTTCCACGACCTCCTCTCAAGAGAACTGGGAAAAGGGTTGCC ATTGTTGGAAGCGGACCAGCTGGTCTAGCTGCTGCTGATCAACTAAACAGATTAGGCCAT ATGGTGACTGTGTATGAGCGTGCTGATAGAATTGGAGGGCTCATGATGTATGGAGTTCCT AATATGAAGGCTGACAAAGTGGATATAGTTCAACGGCGGGTTAACCTTATGGCTGAGGAA GGTGTCAACTTTGTGGTTAATGCTAGTGTTGGAAATGATCCTTTGTACTCGCTTGATCGC CTTCGAGAGGAGAATAATGCCATTATTTTAGCAGTAGGAGCAACAAGACCAAGGGACCTT CCTGTACCAGGGCGAGAGTTGTCAGGTGTTCATTTTGCTATGGATTTCCTTAACGCAAAC ACCAAAAGCTTACTAGATAGCAATCTTCAGGATGGTAACTATATTTCTGCTAAGGGCAAG AAAGTTGTGGTAATTGGTGGAGGTGACACTGGCACTGATTGCATAGGAACATCCGTTAGA CATGGCTGTAGTAGCATCATAAATTTGGAGCTTCTCCCTCAGCCACCACGAACAAGGGCT CCAGGAAACCCTTGGCCACAGTGGCCTCGTGTATTCCGTGTAGATTACGGGCACCAAGAA GTTGCAGCTAAGTTTGGCAAAGATCCAAGATCTTATGAGGTGCTTACTAAGAGATTTGTG GGAGATGAGAATGGGGCTGTGAAAGGACTTGAGCTGGTTCGTGTCAAATGGGAGAAGGAT GCTACTGGGAAGTTCCAATTCAAGGAAATCGAGGGCTCTGAGGAGATCATTGAGGTTGAC CTAGTCCTACTAGCAATGGGTTTCCTTGGACCTGAGGCGAAGGTAGCAGAGAAGTTGGGG TTGGAGCGTGACAATCGCTCAAACTACAAGGCGGAGTATGGTCGGTTCTCAACCAATGTG GATGGGGTATTTGCAGCTGGGGACTGCCGGCGTGGTCAATCCCTGGTGGTGTGGGCAATC TCAGAGGGGCGGCAAGCTGCTGCACAGGTTGACAAATACCTCTCCATTGAGGAAGAAGAA GACCACACCATTAGCAATGGGAGCCATGAAAATATTTTGAAGAGGCATCAAGATCTTAGC AAGAGGAGCACAGGTAGTAGCAAACACACAGTGATGACATAG
PEP MRVIGHNGEINTLKGNVNWMKAREGLLKCKELGLSRNELKKLLPIVDASSSDSGAFDGVL EFLVQAGRSLPEAMMMMIPEAWQNDKNMDPHRKALYEYFSSLMEPWDGPALISFTDGRYL GATLDRNGLRPGRFYVTHSGRVIMASEVGVVDIPPEDVSRKGRLNPGMMLLVDFENHIVV DDEALKQQYSLARPYREWLERQKIELKDIVASVQESDRVPPSIAGVIPASTDDENMENMG IHGLLAPLKAFGYTVESLEMLLLPMAKDGVEALGSMGNDTPLAVMSNREKLTFEYFKQMF AQVTNPPIDPIREKVVTSMECMIGPEGDLTETTEEQCHRLSLKGSLLTIEEMEAIKKMNY RGWRCKVLDITYSKERGREGLEETLDRICAEAHEAIKKGYTTLVLSDRAFSPKRVAVSSL LAVGSVHQHLVKNLERTRVGLIIESAEPREVHHFCTLVGFGADAICPYLAIEAIWRLQVD GKIPPKANGVIYSKDELVKKYFKASNYGMMKVLAKMGISTLASYKGAQIFEALGLSSEVI ERCFAGTPSRVEGATFEMLARDELHMHELAFPSRTFPPGSAEAVALPNPGDYHWRKGGEV HLNDPFAISKLQEAARTNSVAAYKEYSKFIHELNKACNLRGLLKFKSTEQKIHLDEVEPA SEIVKRFCTGAMSYGSISLEAHTTLAMAMNRIGGKSNTGEGGEQPSRMEPLPDGSRNPKR SAIKQVASGRFGVSSYYLTNADELQIKMAQGAKPGEGGELPGHKVIGDIAVTRNSTAGVG LISPPPHHDIYSIEDLAQLIHDLKNANPAARISVKLVSEVGVGVVASGVVKGHADHVLIS GHDGGTGASRWTGIKNAGLPWELGLAETHQTLVANDLRGRTTLQTDGQLKTGRDVAIAAL LGAEEFGFSTAPLITLGCIMMRKCHKNTCPVGIATQDPVLREKFAGEPEHVINFFFMVAE ELREIMSQLGFRTLNEMVGRSDMLEVDKEVTRNNEKLDNIDLSLLLRPAADLRPDAAQYC VQKQDHGLDMALDHKLISLSKAAIEKSLPVYFETTICNVNRAVGTMLSHEVTKRYNREGL PADTIHIKFNGSAGQSLGAFLCPGIILELEGDSNDYVGKGLSGGKIVVYPPKKSKFDPKE NIVIGNVALYGATSGEAYFNGMAAERFCVRNSGARAVVEGVGDHGCEYMTGGTVVVLGKT GRNFAAGMSGGIAYILDVDGQFRSRCNLELVDLDKLEEEDVMTLKMMIQQHQRHTNSLLA SQVLADFGNLLPKFIKVIPREYKRVLANMKDEASKQDAVDEAEQDEPELIEKDAFEELKK LAAASSLNGKSNQTVEDSEILKRPSQVSDAVKHRGFISYEREGVQYRDPNVRMNDWKEVM EETKPGPLLKTQSARCMDCGTPFCHQENSGCPLGNKIPEFNELVYQNRWHEALERLLETN NFPEFTGRVCPAPCEGSCVLGIIENPVSIKSIECAIIDKAFEEGWMVPRPPLKRTGKRVA IVGSGPAGLAAADQLNRLGHMVTVYERADRIGGLMMYGVPNMKADKVDIVQRRVNLMAEE GVNFVVNASVGNDPLYSLDRLREENNAIILAVGATRPRDLPVPGRELSGVHFAMDFLNAN TKSLLDSNLQDGNYISAKGKKVVVIGGGDTGTDCIGTSVRHGCSSIINLELLPQPPRTRA PGNPWPQWPRVFRVDYGHQEVAAKFGKDPRSYEVLTKRFVGDENGAVKGLELVRVKWEKD ATGKFQFKEIEGSEEIIEVDLVLLAMGFLGPEAKVAEKLGLERDNRSNYKAEYGRFSTNV DGVFAAGDCRRGQSLVVWAISEGRQAAAQVDKYLSIEEEEDHTISNGSHENILKRHQDLS KRSTGSSKHTVMT


| Top |