Cherry SNP DataBase

Gene information

Gene Pav_sc0001335.1_g150.1.mk
Chromosome name PAV_r1.0chr2
start 24254570
end 24259043
PAV_r1.0 name Pav_sc0001335.1
start 60881
end 65354
direction -
Annotation NR PREDICTED: probable plastid-lipid-associated protein 14, chloroplastic
Sequence CDS ATGGCACTCTGTGGGGTTGGTTTGAGCCCAAGTTTTGAAAGTTTTGAAGTAGTTTGTGTT GGTGGAAATTTGTCGACAAGACGCATCAGACCGAGCCTTATGCGTGCCATTGGGAAGTCA TCTGATTGGAAGAGAAGACCATGTTTGGGAGTGCGTTGTTCATCACTGAAATTGGACGGC AATGCTCAGACTGACATATCTGTCCCGGTGGAGGAAGAATCAGGTCATGTCATCAAGTTC AAGATTTCTGATTTCAAGGTTCTCGACCGTGTTAGTGTTGGCCTTGGCGGTCGGGCAGGC GAAGTAGTTTTTGAAGCTATAGTGAAGGACACTGATAGTCCTTTGTATAATACACAAGTT GTACTTCGACGTCTTACTAGTGTTCGAGCTCAGCGTAGGGGTAAACGAGCAATAGAGGTC TTAAAGAAGTTAGCTCGGCGTAGACTTATGTACCATTCGTATTCAATGCAAGTTCATGGT TACATCTCTTCAGCTATAACTAGTGGTCGTTCCTCATTCACTCTGGTCCACGGGTATCAT GGTAGTTTTTCTTTAAGACATTGGCTACAACAATCGGATTGGCTTCCAACCTTGGAGGCT ACTCTTGCATTGGACAAGGAATCTGTTAGAAGGGTGGGAGATGATACAGTTGGAGGATCT GCAGTTTCTCGGCAACTGCGAATGATTAGAATACTAATGAGAGATCTCTTAATTGGAGTG AATTACTTGCACAGCCATGGACTTGCCCACACAGAGTTGAGGCTGGAGAATGTGCACATA AGCCCAGTGGATAGACATATTAAAGTAGGAATATTAGGAAATGCTGCTGACTTTTATGAC GACAGTCCGAATTGTGGTACTGCAGACAATAACATGGATAGGCGACAAATGATGATTGCA TTTGACATGAGATGTCTTGGATTCATGATGGCAAAAATGGTGCTGCGGGAACTCATGGAT CCCTTAATATTCACAAAGTTCAAATCATTTCTCACAAAGGGAAATGATCCTTCATGCTTG CGTGAATTTTTGTTGCAAATACTCCACAGAAACTCCTCATCTGGAAACGCTGGACTCCAA ATACTTGATAGGAATTGGGGTGCAGGGTGGAACCTTTTATCCTTATTGCTAGCAACAGAA CCTTCTAAAAGAGTAAGTTGCTTAGATGCTCTTACTCATCCATTTCTATGTGGACCTCGA TGGCGGGTAGTCCCGTCCATTGATATCATCAGATGGGGTCTTGGCTCAACTGCATTGCGA ATCTCAGAAGAATACATTTACGGCCAGCCTCAGCGAAGTAGGCTATCCCACTTCATCGAG TTAATGGAGATGCTGAATCCAAATTCAAGGCCAAAGAATTGGCTGGAATTGCTGCCTGGA AAGTGGCGTCTATTGTACTGTACTGGGAGGCACATTGGTTTAACCTTTCGGCAACCTCCT GAACAAGTCCTCATCGGTCACGTGCACCTAACTGTATCAAGAGTTTCCAAGTTGAACACC AGCCTTTTGTTTGCCTCCAACATCAGCTTCACGGTCATGATTGGTCAGGACTGGCCCCAT GACAAGGCTGGTGTAGATGGGAAGCTCCAAGTAAACTCTTTATTTAGATTAATGGCTGGG AGACGGTTATATCTTAAGGAAGAAGAAAAGAACACAGAAAAGCTCTCCAATACATCAAAC ACTCGTGATGCTTTTGCTCAGAAATTGTCAGGTAGAAAGTGGAGGAAAGCACTGCCGTTT AAGGAGTCTCCGTCGAGCCTTCCGGTGGCAAAGCTTGTTTCAAGTGGCATTGATGAAGTA ACGATGAATCTGGGTGATCCATTGAGTAAAAGTATCAATAGTGCAACAAATGTAGTTCAA GAAGTCCGGACACAGGTCCCACCTGAAATGTTCGATTTGTCAAAGCTTGTGTGTGGAACA TACGTCGACTCCAGGCTGCTGGTAATTCGAGGGGTAAATGGTTCAGCACTCTTATTCACA AGGTCATGTTTTGATGAAAGCTGTAAATAA
PEP MALCGVGLSPSFESFEVVCVGGNLSTRRIRPSLMRAIGKSSDWKRRPCLGVRCSSLKLDG NAQTDISVPVEEESGHVIKFKISDFKVLDRVSVGLGGRAGEVVFEAIVKDTDSPLYNTQV VLRRLTSVRAQRRGKRAIEVLKKLARRRLMYHSYSMQVHGYISSAITSGRSSFTLVHGYH GSFSLRHWLQQSDWLPTLEATLALDKESVRRVGDDTVGGSAVSRQLRMIRILMRDLLIGV NYLHSHGLAHTELRLENVHISPVDRHIKVGILGNAADFYDDSPNCGTADNNMDRRQMMIA FDMRCLGFMMAKMVLRELMDPLIFTKFKSFLTKGNDPSCLREFLLQILHRNSSSGNAGLQ ILDRNWGAGWNLLSLLLATEPSKRVSCLDALTHPFLCGPRWRVVPSIDIIRWGLGSTALR ISEEYIYGQPQRSRLSHFIELMEMLNPNSRPKNWLELLPGKWRLLYCTGRHIGLTFRQPP EQVLIGHVHLTVSRVSKLNTSLLFASNISFTVMIGQDWPHDKAGVDGKLQVNSLFRLMAG RRLYLKEEEKNTEKLSNTSNTRDAFAQKLSGRKWRKALPFKESPSSLPVAKLVSSGIDEV TMNLGDPLSKSINSATNVVQEVRTQVPPEMFDLSKLVCGTYVDSRLLVIRGVNGSALLFT RSCFDESCK


| Top |