Cherry SNP DataBase

Gene information

Gene Pav_sc0001335.1_g190.1.mk
Chromosome name PAV_r1.0chr2
start 24232035
end 24239297
PAV_r1.0 name Pav_sc0001335.1
start 80627
end 87889
direction -
Annotation NR PREDICTED: histone-lysine N-methyltransferase ATX5
Sequence CDS ATGATAATCAAGAAGAACCTCAAATCCCAAATGCCGAGTCTGAAAAGGTGCAAACTCGGC GAGTCAGCGGGTGAGGACGAAGATAACTCGGGCAGGAAGAAGAGGAAGACTAATGGGTAT TACCCTCTCAATCTACTCGGCGAGGTCGCCGCTGGTATTATACCGGTCAGTCTTCACGGT TTGCTCGGTTCAGTTGGGGCCGAGAAGGGCTTCTCTGCTTCGTGGTGCACCGAAGTCTCG TGCTCCCCCGAGGTGGAGTTGAAATCGAAGAACAGAGAGTCAGCCAAAGCGAAGACTAAT CGGACGACAGAAGTTTCGCGGCCGCCTCTGGTGAGGACTTCGAGGGGCCGAGTTCAGGTA CTTCCTTCTCGGTTTAATGACTCGGTTATTGAGAACTGGAAGAAAGAAAGTAAGACTAGT TTGCGTGATTATAGTATAGATGAGGAGATTGAGTGTAAAAAAGAGAAAGCTAGCTTTAAA GCCCCCAAACAAGGTAGCCAAAATGCCAAAAAGACACGAAATGCTGAGAGAATTGGATAT AACAGTAAGAAGTATTCGGGTTTGTGTGAAGAAGAAGATGAAGTAGAGGAAGAGGGGAGT ATGCGGTTTAGAAGTTTAGATATTAGGAAGTATTCGAGCTCACGTAGTACACTCACGTCA GTGCATGAGCAATTGGTTGAAGATGACAAGTGTCCAGTTGCAGAAATTGATGAACAAGTT GATTTAGTGGGCACAGTGAGGGCTTCAAAGGAGAGGAAAGATGGATTGTATGGACCTGAA GACTTTTATTCGGGTGATACAGTGTGGGCGAAGCCAGGGAGAAAGGAGCCTTTCTGGCCT GCCATTGTTATTGATCCAATTTCGCAAGCGCCTGAGCTAGTTTTGAGGGCTTGCATACCA GATGCAGCATGTGTGATGTTCTTTGGATACTCTGGGAATGAGAATCAAAGGGATTATGCT TGGGTCGGACGAGGGATGATTTTTCCCTTTATGGATTATGTGGACAGGTTCCAGGCGCAG TCCGAATTGAACAGCTGCGAGCCCTGTGAATTCCAGATGGCAATTGAGGAGGCATTTTTG GTGGAACAAGGGTTTACGGAAAAGTTGATAGCAGATATCAACATGGCAGCAATGTATGAT GACTCTCTACTTGGAGGGGTTCAAGAGGCTACGGGTTCAAATCATGATCTGGACTGTCAA TTACTGAATCAGGCAAGTTCTCTTAGAGCGCTCTTTCCTGACGTATATGGGAAGAAGAGA GACATACGACCCTGTGAAGGCTGCGGTGTTTACCTTCCTTTTAAAATGACAAAGAAAATG AAGGTTTCAACTCCTGGAGATCAATTTCTTTGTAAAACGTGTGCTAAGTTAACAAAATCA AAGCATTATTGTGGCATATGCAAGAAGATTTGGAATCATTCAGACAGTGGAAGTTGGGTG AGGAATCCTACAAGACATGTTCGCTGTGATGGTTGTAAAGTGTGGGTGCATGCAGAATGT GACAAAATTTCCAGCAACCTTTTTAAGAATTTGGGAGGCACTGAGTACTACTGCCCTACT TGCAAAGTGAAATTTAATTTTGAATTATCAGATTCTGAAAAAGGGCAACCAAAAGTAAAA TTGAGTAAAAATAATGGTCAGTTGGTGCTGCCTAACAAGGTTACTGTTCTCTGCAATGGC GTGGAAGGCATTTATTTTCCAAGTCTTCACTCAGTCGTGTGCAAGTGTGGTTTTTGTGGG GCAGAAAAACAAGCACTTAGTGAATGGGAGCGACATACAGGATCCAAATCAAGAAATTGG AGGACTAGTGTCAAAGTGAAAGGTTCTTTACTGCCACTGGAACAATGGATGCTGCAGTTA GCAGAGTATCATGAAAATGCTATTGTGTCTTCCAAACCTCCTAAACGGCCTTCTATTAAA GAAAGAAGGCAGAAATTGCTTACTTTTTTGCAAGATGTCAAATAG
PEP MIIKKNLKSQMPSLKRCKLGESAGEDEDNSGRKKRKTNGYYPLNLLGEVAAGIIPVSLHG LLGSVGAEKGFSASWCTEVSCSPEVELKSKNRESAKAKTNRTTEVSRPPLVRTSRGRVQV LPSRFNDSVIENWKKESKTSLRDYSIDEEIECKKEKASFKAPKQGSQNAKKTRNAERIGY NSKKYSGLCEEEDEVEEEGSMRFRSLDIRKYSSSRSTLTSVHEQLVEDDKCPVAEIDEQV DLVGTVRASKERKDGLYGPEDFYSGDTVWAKPGRKEPFWPAIVIDPISQAPELVLRACIP DAACVMFFGYSGNENQRDYAWVGRGMIFPFMDYVDRFQAQSELNSCEPCEFQMAIEEAFL VEQGFTEKLIADINMAAMYDDSLLGGVQEATGSNHDLDCQLLNQASSLRALFPDVYGKKR DIRPCEGCGVYLPFKMTKKMKVSTPGDQFLCKTCAKLTKSKHYCGICKKIWNHSDSGSWV RNPTRHVRCDGCKVWVHAECDKISSNLFKNLGGTEYYCPTCKVKFNFELSDSEKGQPKVK LSKNNGQLVLPNKVTVLCNGVEGIYFPSLHSVVCKCGFCGAEKQALSEWERHTGSKSRNW RTSVKVKGSLLPLEQWMLQLAEYHENAIVSSKPPKRPSIKERRQKLLTFLQDVK


| Top |