Cherry SNP DataBase

Gene information

Gene Pav_sc0001335.1_g260.1.mk
Chromosome name PAV_r1.0chr2
start 24183287
end 24193062
PAV_r1.0 name Pav_sc0001335.1
start 126862
end 136637
direction -
Annotation NR PREDICTED: dipeptidyl peptidase 8
Sequence CDS ATGGGCTGCTATTGGTCAAAGAAAGCTAAAACCCCTGGCTATGAGGACCCTGCAGTTCTT GCTGCTGAAACACCCTTTACAGTGAATGAAGTAGAAGCCTTGTATGAGCTTTTTAAGAAA CTGAGCAGTTCAATATTTGATGATGGGCTTATCCACAAGGAAGAATTTCAGCTTGCACTC TTCAAAAACAAAGATAAGAGGAATCTTTTTGCTGACAGGATTTTTGACTTATTTGATGTC AAGCGCAATGGTGTTATTGAGTTTGGAGAATTTGTTCGATCATTGGGTGTCTTTCACCCT AATGCACCTTTGAAGGAGATGGTGCTGGCACTTTTGCATGAATCAGAACTTGTACTCTCG GATGATGTGATCGAAGTGATTGTGGATAAGACATATAGTGAAGCAGATAAGAAAGGGGAT GGACGTATTGATCAAGAAGAGTGGAGGGAATTTGTATTGAAGCATCCATCTTTGATAAAG AATATGACTCTACCATATTTAAATTGTATTGTAATGCAATCAGTTGATGAGGAGAATAAT AAGAAGAAGAATTTGAAGCGTTCAAGATCATCTAGTTACGACATGCCTGTGACTGACTCC AATTTTGCACAAAGTCTTGATGACTGTGTTCTTTTCCCAGTGGAAGAGATTGTGCAATAC CCATTGCCTGGATACGTTGCTCCAACTTCAATCAGTTTCAGTCCTGATGATACTATTATA ACATATTTGTTTAGTCCTGATCACACTTTGAATAGGAAGGTATTTGCTTTTGATCTCAAA ACTTGCAAGCAAGAATTGTGTTTCAGTCCTCCTGATGGTGGACTTGATGAGAGCAATATA TCACCAGAAGAAAAGTTGAGGAGAGAGAGGTTGAGGGAGCGTGGGTTGGGAGTGACACGG TATGAATGGGTGAAAACAAGCTCCAAAAAGAAAGCAATCATGGTTCCATTGCCAGCTGGG ATTTATTTCCAGGATCTTTCCCATTCAAAAGCAGAGCTCAAGCTTCCAAGCACATCAGGT TCACCAATTATTGATCCGCATCTATCCCCAGATGGTACAATGCTTGGTTATGTAAAAGAT TGCGAGTTGCATGTACTGAATTTGATATGCAATGAATCTAAACCGTTAACATATGGTGCC AGACCCAGAGGAAATGATTTGACTCACGGCCTTGCTGAATATATAGCTCAGGAAGAAATG GATCGGAAGAATGGGTACTGGTGGTCCCTAGACAGCAAATTCATTGCATTCACAGAAGTT GATTCTTCCGATATCCCTCTTTTCAGAATCATGCATCAAGGTAAAAGCTCTGTTGGTTCA GAAGCTCAGGAAGATCATCCTTATCCCTTTGCTGGAGCTTCAAATGTCAAAGTTCGCCTA GGAGTGGTTTCTTCTTCTGGAGGTCCTATTACTTGGATGGATCTTCTGTGCGGGGGAACA GATCAACCAGACAGTGAAGAGGAATATCTGGCAAGAGTAAATTGGATGCATGGAAATACT TTAATAGCTCAGGTTCTGAACAGGTCCCACAGCAAACTAAAGATCCTTAAATTTGACATT AAAACTGGGAAGAGAAAAGTTTTGTTGGTAGAAGAACAAGGAACGTGGGTTACCTTACAT GACTGCTTCACACCTCTAGACAGAGGAGTAACCAAATTTTCAGGGGGATTTATCTGGGCA AGTGAGAAAACAGGATTTAAACATCTTTATCTGCATGATGCCAATGGAACATGTTTAGGA CCTATCACCGAAGGAGATTGGATGGTTGAGCAGATTGCCGGTGTAAATGAAGCTGCGGGA CTTGTTTATTTCACTGGAACCTTGGAGGGACCTTTAGAGTCACACCTTTATTGTGCAAAA CTATTTACGGATGGAAATCAAGCCTTGCAAGGGCCAGTGAAGTTGACTCACAGCAAGGGG AAGCATGTAGTGGTGCTTGATCATCATATGAAGAATTTTGTTGATATCCATGATTCCCTT GATTCTCCCCCTAAAGTTTTACTCTGCTCCTTGCTCGATGGAAGCTCAATTATGCCTCTG TATGAGCCGTCATTTACGGTTCCAAGATTCAAAAGGCTTCAACTTGAGCCACCTGAGTTG GTTCATTTACGGGCTAATGATGGGACAACATTGTATGGAGTTCTATATAAGCCTGATGAA GCAAGATTTGGGCCTCCTCCTTACAAAACTTTGATCAGTGTGTATGGTGGACCAAGCGTA CAGCTTGTCTCTGATTCTTGGATAAATACAGTTGACATGAGAGCGCAGTATCTAAGAAGC AAAGGAATTTTAGTATGGAAGTTAGATAACAGAGGAACTGCTCGGCGGGGACTAAAGTTT GAAGGCTCTTTAAAATACAATGTTGGTCGTATTGATGCTGATGATCAGCTAACTGGAGCT TTGTGGCTTTTAGAAAAAGGCTTAGCAAAAGTAGGGCACATTGGGTTGTATGGTTGGAGC TATGGTGGATATCTTTCAGCTATGACTTTGGCGAGGTTTCCTGATGTCTTCCGGTGCGCA GTGTCCGGTGCCCCTGTTACATCATGGGATGGATATGACACATTCTATACAGAGAAATAC ATGGGGCTGCCTTCTGAGAAGGAAGAAGGATATGAGTATAGCTCCGTGATGCACCATGTG CACAAGATGGAAGGAAGGTTGTTACTTGTGCACGGCATGATTGATGAAAATGTGCATTTC AGGCATACTGCCAGGCTTGTCAATGCACTTGTTGCAGCTGGTAAGTCGTATGAACTATTA ATTTTCCCAGATGAACGTCACATGCCGCGCCGGCATAGGGATCGGATTTATATGGAAGAG AGAATTTGGGAATTTATAGAAAGAAATTTGTGA
PEP MGCYWSKKAKTPGYEDPAVLAAETPFTVNEVEALYELFKKLSSSIFDDGLIHKEEFQLAL FKNKDKRNLFADRIFDLFDVKRNGVIEFGEFVRSLGVFHPNAPLKEMVLALLHESELVLS DDVIEVIVDKTYSEADKKGDGRIDQEEWREFVLKHPSLIKNMTLPYLNCIVMQSVDEENN KKKNLKRSRSSSYDMPVTDSNFAQSLDDCVLFPVEEIVQYPLPGYVAPTSISFSPDDTII TYLFSPDHTLNRKVFAFDLKTCKQELCFSPPDGGLDESNISPEEKLRRERLRERGLGVTR YEWVKTSSKKKAIMVPLPAGIYFQDLSHSKAELKLPSTSGSPIIDPHLSPDGTMLGYVKD CELHVLNLICNESKPLTYGARPRGNDLTHGLAEYIAQEEMDRKNGYWWSLDSKFIAFTEV DSSDIPLFRIMHQGKSSVGSEAQEDHPYPFAGASNVKVRLGVVSSSGGPITWMDLLCGGT DQPDSEEEYLARVNWMHGNTLIAQVLNRSHSKLKILKFDIKTGKRKVLLVEEQGTWVTLH DCFTPLDRGVTKFSGGFIWASEKTGFKHLYLHDANGTCLGPITEGDWMVEQIAGVNEAAG LVYFTGTLEGPLESHLYCAKLFTDGNQALQGPVKLTHSKGKHVVVLDHHMKNFVDIHDSL DSPPKVLLCSLLDGSSIMPLYEPSFTVPRFKRLQLEPPELVHLRANDGTTLYGVLYKPDE ARFGPPPYKTLISVYGGPSVQLVSDSWINTVDMRAQYLRSKGILVWKLDNRGTARRGLKF EGSLKYNVGRIDADDQLTGALWLLEKGLAKVGHIGLYGWSYGGYLSAMTLARFPDVFRCA VSGAPVTSWDGYDTFYTEKYMGLPSEKEEGYEYSSVMHHVHKMEGRLLLVHGMIDENVHF RHTARLVNALVAAGKSYELLIFPDERHMPRRHRDRIYMEERIWEFIERNL


| Top |