Cherry SNP DataBase

Gene information

Gene Pav_sc0001335.1_g490.1.mk
Chromosome name PAV_r1.0chr2
start 24053335
end 24058298
PAV_r1.0 name Pav_sc0001335.1
start 261626
end 266589
direction +
Annotation NR PREDICTED: probable trehalose-phosphate phosphatase C
Sequence CDS ATGATCATGACAAACCTTGCAAGGCTGAACCAGGCAATGGGACTCCAAAGATCATCAGCT TCTAGTAAGCAGAAGGTGCAACCCATCACACAAGTATTAAAGAACGACGAGAACAGTGGT GATCTTTCCTTAGCATCGATCACCTCAAACCTGCATGATATTTCTAACCCTAATAAACCT ATCCCCTCAGATTTAGCTTATAATTCATGGCTGGTCGAGCACCCTTCTGCATTAGGCTCA TTTGATTGGATGATGAAAGCAGCAAAAGGGAAGAGGATTGTTGTCTTTCTAGACTACGAT GGGACCCTTTCACCAATTGTTGATGATCCTGATCTTGCTTTCATGTCTGATGAGATGCGT GCAGCGGTACGGGAAGTTGCCAAGTATTTTCCAACAGCAGTGATCAGCGGAAGGAGTAGA GATAAGGTTAAAGAATTTGTACAGTTAAGTAATGTATATTACGCTGGCAGCCATGGGATG GACATAATGGTCCCTCCAAGGCCATTAAGGCCCTGTGATGCCAACAACTACACCACTGCC ATGGATATAAAGGGCAGTGACGTTCTCTTTCAACCTGCTAAAAGATTTCTTCCTGCAATC CAAGAGATAAGAACACTGTTGGAGGAAATAACCAGAAAAGTAGAGGGTGCAAGGGTAGAG GACAATAGATTCTGTATCTCTGTACATTTTCGCAAGGTCCGGGAAGAGGATTATGGGATA TTAGAAGAGAAGGTGAAGTCTGTTGTTGGAAAGTATCCGGAATTTCACCTGACGCTGGGT AAAAAGGTGTTGGAAATACGACCATCCATAGAATGGAACAAAGGTCATGCGCTAGAATAT TTGCTTGACACTCTAGGCTTCAGCAATTCCAGCGATGTCCTCCCACTGTACATCGGGGAC GATCGAACTGATGAAGATGCTTTCAAGGTGATACGAAGTAGAGGTCAAGGGTTTCCAATA ATTGTGTCTTCAACCCAAAAGGAGGACACCAAAGCTTGTTATTCTTTGCATGACCCATCG GAAGTATTAACTTTCTTGTTAAGGCTCGCCCGGTGGAGAAAAGCCTCTTCTTCAAGCAGG TCACTAGCTCAAATTTGGGGTGTTGGTAGTAACTTACCTAGATCAGTTTAG
PEP MIMTNLARLNQAMGLQRSSASSKQKVQPITQVLKNDENSGDLSLASITSNLHDISNPNKP IPSDLAYNSWLVEHPSALGSFDWMMKAAKGKRIVVFLDYDGTLSPIVDDPDLAFMSDEMR AAVREVAKYFPTAVISGRSRDKVKEFVQLSNVYYAGSHGMDIMVPPRPLRPCDANNYTTA MDIKGSDVLFQPAKRFLPAIQEIRTLLEEITRKVEGARVEDNRFCISVHFRKVREEDYGI LEEKVKSVVGKYPEFHLTLGKKVLEIRPSIEWNKGHALEYLLDTLGFSNSSDVLPLYIGD DRTDEDAFKVIRSRGQGFPIIVSSTQKEDTKACYSLHDPSEVLTFLLRLARWRKASSSSR SLAQIWGVGSNLPRSV


| Top |