Cherry SNP DataBase

Gene information

Gene Pav_sc0001338.1_g280.1.mk
Chromosome name PAV_r1.0chr7
start 4758996
end 4765358
PAV_r1.0 name Pav_sc0001338.1
start 145855
end 152217
direction -
Annotation NR PREDICTED: NADPH-dependent thioredoxin reductase 3
Sequence CDS ATGGCTGCGGCGGGTGTCAAGATAGGAACCGGTTTCGAGACCGTTCCGACTCACCGAGTC ACCACCATGTCCATTTCCTCTCTCCTTCCTCCTCCTCCTCACCACACTCTCTTCTTCCTC AGAACCCGCCCTCGCCCCCTCTCTCTCCCTCTCCTCTCTCCTCCACGCTCACGCCCTCGC TCTCTCCCTCTCCGAGCTTCCTCCGAGTCTCCTCCTACCTCTCAAGCAAATGCAATCGAG AATGTGGTGATAATTGGGTCAGGTCCAGCTGGATTCACAGCAGCAATATACGCAGCTCGA GCCAATTTGAAGCCTCTGGTGTTTGAAGGGTATCAATCGGGCCCGGGGGGGCAGTTGATG ACCACTACTGAAGTTGAAAACTTTCCAGGATTCCCAGATGGAATTACTGGTCCTGATTTA ATGGACAGGATGCGGCGACAAGCCGAACGCTGGGGAGCAGAGTTGTACCAGGAAGATGTT GAGTCTATTGATGTCAAAACTAGACCTTTTACTGTGGAAAGTAGTGAGCGTAAGGTTAAG TGCCACAGTCTAATTTTTGCCACAGGAGCTACTGCAAAACGGCTTAGGATACCCCGTGAA GATGAATTTTGGAGTAGGGGAATTAGTGCTTGTGCAATTTGTGATGGAGCATCACCATTG TTTAAAGGGCAAGTTCTTGCTGTGGTTGGAGGGGGTGATACAGCTACAGAGGAAGCTTTA TACCTCACAAAATATGCTCGTCATGTTCATCTACTTGTGCGTAGAGATCAACTAAGAGCT TCTAGAGCAATGCAAGATAGAGTGTACAACAACCCAAATGTCACCTTGCACTTCAACACA GAGACTGTGGACGTTGTTAGCAATACAAAAGGCCAGATGTCTGGTATTTTAATTCGAAAA CTTGATAGTGGGAAGGAATCTGTGCTTGAAGCAAAGGGGTTATTTTACGGTATTGGTCAT TCACCAAATAGCCAGTTGTTGGAAGGCCAAGTTGAGCTTGACAGCTCTGGCTACATCTTA GTAGAGGAGGGTACTGCAAAAACTTCAGTTGAAGGTGTATTTGCTGCTGGAGATGTACAG GACCATGAATGGAGGCAAGCCGTAACTGCTGCAGGTTCTGGATGCATTGCCGCTTTATCA GTTGAGAGATATCTTGTGGGAAAAGATCTCATTATTGAGTTTCACCAGCCCAAAACTGAA GAGGCTAAGAAGGAACTCACAAGCAGGGATGTTCAAGAAGGTTTTGACATTACTCTTACA AAGCATAAGGGCCAGGCATGTTATGCCCTACGAAAATTGTACCATGAAAGTCCAAGGCTT ATATGTGTACTATATACAGCACCAACATGTGGTCCGTGTAGGACTTTGAAGCCAATTCTT AGTAAGGTGATAGATGAATTCGACCAAAATGTACATTTTGTTGAAATTGATATTGAGGAT GATCCAGAAGTAGCAGAAGCAGCTGGAATTATGGGTACACCATGCGTTCAGTTCTTCAAA AATAAAGAAATGATCAGGACTATATCGGGGGTCAAAATGAAGAGCGAGTATAGACAATTT ATTCAAGCAAATAAATGA
PEP MAAAGVKIGTGFETVPTHRVTTMSISSLLPPPPHHTLFFLRTRPRPLSLPLLSPPRSRPR SLPLRASSESPPTSQANAIENVVIIGSGPAGFTAAIYAARANLKPLVFEGYQSGPGGQLM TTTEVENFPGFPDGITGPDLMDRMRRQAERWGAELYQEDVESIDVKTRPFTVESSERKVK CHSLIFATGATAKRLRIPREDEFWSRGISACAICDGASPLFKGQVLAVVGGGDTATEEAL YLTKYARHVHLLVRRDQLRASRAMQDRVYNNPNVTLHFNTETVDVVSNTKGQMSGILIRK LDSGKESVLEAKGLFYGIGHSPNSQLLEGQVELDSSGYILVEEGTAKTSVEGVFAAGDVQ DHEWRQAVTAAGSGCIAALSVERYLVGKDLIIEFHQPKTEEAKKELTSRDVQEGFDITLT KHKGQACYALRKLYHESPRLICVLYTAPTCGPCRTLKPILSKVIDEFDQNVHFVEIDIED DPEVAEAAGIMGTPCVQFFKNKEMIRTISGVKMKSEYRQFIQANK


| Top |