Cherry SNP DataBase

Gene information

Gene Pav_sc0001339.1_g050.1.mk
Chromosome name PAV_r1.0chr6
start 17083108
end 17085267
PAV_r1.0 name Pav_sc0001339.1
start 26490
end 28649
direction +
Annotation NR PREDICTED: adenylate kinase 1, mitochondrial
Sequence CDS ATGGCGGCCTTAACTCGCCTATCAAAGCCCTCGTTCACATCACTCTCCTCCGTCTCACGC ATAAGCCGGTGCTTCTACTCGGGCATAGCACCGGAGCCCAGCTCTCATGGCGCTTCGCCA TATAGCCCACGATTGGGGCCCAAGCCCAATCTCTCGATCAAGGACCCCAAGGATCGAAAC GTACAGTGGGTCTTCTTGGGCTCACCGGGCGTGGGCAAAGGCACGTACGCGAGCCGGCTC TCTAATCTTCTCGGCGTTCCTCACATCGCCACTGGAGATCTCGTCCGCGAAGAGCTTGCA GCCTCTGGGTCTCTCTCTAAAGAGTTATCAGAGATTGTGAACCAGGGGAAGTTGGTTTCT GATGAAATTATAATAAGCTTGTTGTCGAAGAGATTGGAGGCTGGGGGAGCTAAAGGGGAA CTGGGTTTTATTCTTGATGGGTTTCCTCGAACCATAAGACAAGCGGAAATATTGGAAGGG GTGACGGAGATTGACCTGGTGCTCAATCTGAAGCTCCGGGAAGATGTGTTGGTTGAGAAA TGCCTTGGGAGGAGAATGTGTAGTCAGTGTGGGGGAAATTTCAATGTGGCCTCCATTAAT GTTAAGGACTCGAATGGGAGTCCTGCAATTAGCATGGCTCCGCTTCTTCCACCTCCACAT TGTATGTCAAAGCTTGTTACTCGAGCCGATGATACTGAAGAAGTGGTTAAACATCGGATT CATGTATACAATGAGAAGATTCCTCTTGCAGCTGGCCGAGTTGATTGGCTCAAGTACTGC CAATCAGCAAGTTATCAGCTGCAGATATTGAATTTCGGCACAATACCAGCTCTTGACTGC AGAAGTTTGAGCGGTGCAAGATAG
PEP MAALTRLSKPSFTSLSSVSRISRCFYSGIAPEPSSHGASPYSPRLGPKPNLSIKDPKDRN VQWVFLGSPGVGKGTYASRLSNLLGVPHIATGDLVREELAASGSLSKELSEIVNQGKLVS DEIIISLLSKRLEAGGAKGELGFILDGFPRTIRQAEILEGVTEIDLVLNLKLREDVLVEK CLGRRMCSQCGGNFNVASINVKDSNGSPAISMAPLLPPPHCMSKLVTRADDTEEVVKHRI HVYNEKIPLAAGRVDWLKYCQSASYQLQILNFGTIPALDCRSLSGAR


| Top |