Cherry SNP DataBase

Gene information

Gene Pav_sc0001342.1_g170.1.mk
Chromosome name PAV_r1.0chr4
start 7233928
end 7239152
PAV_r1.0 name Pav_sc0001342.1
start 138794
end 144018
direction +
Annotation NR PREDICTED: APO protein 1, chloroplastic
Sequence CDS ATGTTCCATAAGCCTCCAACAGTCTCCTCTGCTTTGTGGGAACCATATCAGAAAGGTGCT TGCCTCTGTACCATTGAGTTCAAGCGAACTCAATTATCAGCTGTGAATTCCTATAGTGTC GGGTTCAAGTTTGAGCATGGAAAGCTTCATAAAGGAGGAAGTATTTTGGGAACTATCTTT TCTGCCAGTAGGAAGCCCAGGGTAGAACCAACCTTAAGGAAGCGAGAAGCATATCCCCAA AATGTGGATCTTCCACCCATACTACCTAAGCAAAAGAAGAAACCCTATCCTATTCCCTTC AAGAAGATCAAGCAGGTTGCAAAGGAGGACAAAAAACTTGCAGAAATGGGTATAGAGAAG CCCCTCGACCCTCCGAAAAATGGATTACTTGCCCCTGATTTAATTCCTGTTGCTTACCAA GTACTAGATGCGTGGAAAGTTTTAATTAAAGGCCTTGCACAGCTGTTGCATGTTATTCCT GTATACGGCTGCAATGAATGCTCTGAGGTTCATGTGAGCCACTCTGGTCATCACATGCAG GACTGTCTTGGCCCAACCAATTCCAAGCGCCGAAGCTTCCATTCCTGGATTAAGGGTTCT ATCAATGACATACTTGTACCCATCGAGGCATATCATCTGTATGATCCTTTTGGTCGGCGC ATTAAGCATGAAACTAGATTTCAATATGACAGGATTCCTGCTATCGTGGAGCTGTGCATC CAAGCTGGTGTGGAAATACCGGAGTACCCTTCACGTCGAAGAACCAAACCTATCCGAATG ATTGGAAGGAAAGTAATTGATCGTGGTGGATTGGTTGAGGAGCCACAGCCATGGCGCGCT GCGAATCCATCTTCACTTGCTGATCTCGATACACATGGGGCTTGTGAGCGGTTTCCACCT CCCCTGCCATCAGACATTCCCAAGATTGCACAGGAGACAATGGATGCATATGAAACTGTG AGGTTCGGGGTCATGAAGCTGATGAAGAAATACACTGTGAAGGCGTGTGGGTATTGCACA GAGGTTCATGTTGGACCTTGGGGTCACAACGCAAAGCTTTGTGGGGAATTCAAGCACCAA TGGAGGGATGGGAAGCATGGTTGGCAGGACGCTACCGTGGATGAAGTTTTCCCACCAAAC TATGTATGGCATGTCAAAGACCCTAAAGGACCTCCAATGAAAGGGGGTGCACTCAAGAAG TTCTATGGGAAGGCTCCTGCCGTGGTAGAGGTGTGCTTGCAGGCAGGTGCACGGATCCCT GAGAAATACAAACCCATGATGAGGCTTGACATTGTAGTCCCTGACACTGAGGAGGCACAG TTAGTTGCCTGA
PEP MFHKPPTVSSALWEPYQKGACLCTIEFKRTQLSAVNSYSVGFKFEHGKLHKGGSILGTIF SASRKPRVEPTLRKREAYPQNVDLPPILPKQKKKPYPIPFKKIKQVAKEDKKLAEMGIEK PLDPPKNGLLAPDLIPVAYQVLDAWKVLIKGLAQLLHVIPVYGCNECSEVHVSHSGHHMQ DCLGPTNSKRRSFHSWIKGSINDILVPIEAYHLYDPFGRRIKHETRFQYDRIPAIVELCI QAGVEIPEYPSRRRTKPIRMIGRKVIDRGGLVEEPQPWRAANPSSLADLDTHGACERFPP PLPSDIPKIAQETMDAYETVRFGVMKLMKKYTVKACGYCTEVHVGPWGHNAKLCGEFKHQ WRDGKHGWQDATVDEVFPPNYVWHVKDPKGPPMKGGALKKFYGKAPAVVEVCLQAGARIP EKYKPMMRLDIVVPDTEEAQLVA


| Top |