Cherry SNP DataBase

Gene information

Gene Pav_sc0001364.1_g090.1.mk
Chromosome name PAV_r1.0chr1
start 28034274
end 28037976
PAV_r1.0 name Pav_sc0001364.1
start 29345
end 33047
direction -
Annotation NR PREDICTED: probable U3 small nucleolar RNA-associated protein 7
Sequence CDS ATGGGTGTGAAACAAGATGGTGATGGCACTATTCTACCTCCAACCGAACTGGAGAAGATA CCTGATGGGCTTGATGTGAGTGTGAAGAAGTTTCTTAGAGGAAGCGAAACTAATTTGGAG TGGTTTCTGCCAAGTGAGGGAGGTTATTTGGAGGCTGAAGGCATGGAGAAGACGTGGAGG ATAAAACAAGAATCAATTGCTCGTGAAGTAGATATCTCAAGCGCAAGGAATCAATATGAT ATCGTCCTACCAGTTCTCGGTCCATACATGTTGGATTTCACATCAAGTGGTCGCCATATG GCAGTCTGCAGACTCAAGGGCCATATGGCTATTGTAGACATGAAAAATATGAGGCTGATT AAAGAATTTCAGTTATGCTGTGCAGTTAGGGAAACAGTGCGTGATGTGGTGTTCCTACAC AATGAGTCATTCTTTGCTGCAGCCCGGAAAAAGAACATGGTGAACCACTTCCTCTTGGCT TCAATAAACAATTTTGCGCAGCTTCATTATCAAGATGTTACAATGGGTGAGATGGTAGGT AGTTACAGAACTGGGTTAGGCCGTGCTGATGTGATGCAGGGGAACCCCTACAATGGGTTT GTTGCTTTGGGTCCTTCACTTGGTACAGTTTCCATGTGGAAGCCTACAAGCTCTGCTCCT CTTCCGAGAAGGCTGTGTCATAGGGGCTCCATCTCGGCAATCGCAGTCCACCCGAATGGC CATCTCATGGCCACAGCTGGAAAAGAGAAGAAAATTAAGCTTTGGGATTTGAGGAAACTT GAGGATGAGGCACTCCATACTTTACCGGGGCAGGCAAAGACTGCGGATTTCAGTCAGAAG GGTCTTCTAGCTTGTCTGGGCAGTGAATCATCTGTACAAATCCTGAGAGATTTGCACGGG ACTCAGAACTACAAGACATATATGAACCATCGAACGGTTAAAGGTTACCAAATAGAAAAG TTGTTGTTTCGACCGTATGAAGATGTTCTAGGCATAGGGCACTCCATGGGTTGGTCCAGT ATTCTGATTCCTGGTTGTGGGGAACCAAACTTTGATTCCTGGGTGGCAAATCCATTTGAA ACATCTAAACAAAGAAGAGAGAGGGAAGTGCACTCTCTGCTTGAGAAGCTGCCACCGGAG ACAATTATGTTGGATCCCACAAAGATTGGCACAGTGAAGCCTCAGAGGAAGAAAGAGAAA CCGACAAAGCAAGAGAAAGAGGTTGAGATTGAAGCTGCTGTTGAAGCTGTCAAGGGCATT GTGAAGAAGAAAACCAAGGGGAGGAATAAGCCGAGTAAGAGGACGACGAAGAAGAAGGAG ATCATTGCAAATGCCAAGAGGCCTTTCTTGGAGCAACAAATGAAGGTGGAAGAACAACTG GCTAGAAAGAAGCAGAAAACAATTGAGCAAGTGGAGCTACCAACATCTTTACAGCGGTTT GCCCGCAGCAAAGCGACTGCATGA
PEP MGVKQDGDGTILPPTELEKIPDGLDVSVKKFLRGSETNLEWFLPSEGGYLEAEGMEKTWR IKQESIAREVDISSARNQYDIVLPVLGPYMLDFTSSGRHMAVCRLKGHMAIVDMKNMRLI KEFQLCCAVRETVRDVVFLHNESFFAAARKKNMVNHFLLASINNFAQLHYQDVTMGEMVG SYRTGLGRADVMQGNPYNGFVALGPSLGTVSMWKPTSSAPLPRRLCHRGSISAIAVHPNG HLMATAGKEKKIKLWDLRKLEDEALHTLPGQAKTADFSQKGLLACLGSESSVQILRDLHG TQNYKTYMNHRTVKGYQIEKLLFRPYEDVLGIGHSMGWSSILIPGCGEPNFDSWVANPFE TSKQRREREVHSLLEKLPPETIMLDPTKIGTVKPQRKKEKPTKQEKEVEIEAAVEAVKGI VKKKTKGRNKPSKRTTKKKEIIANAKRPFLEQQMKVEEQLARKKQKTIEQVELPTSLQRF ARSKATA


| Top |