Cherry SNP DataBase

Gene information

Gene Pav_sc0001369.1_g450.1.mk
Chromosome name PAV_r1.0chr3
start 6367367
end 6372590
PAV_r1.0 name Pav_sc0001369.1
start 195436
end 200659
direction -
Annotation NR PREDICTED: LOW QUALITY PROTEIN: putative pentatricopeptide repeat-containing protein At3g15930
Sequence CDS ATGACATTCTTTCTTGCCCTCAAAGTCAAAACTCACTGGCTCTACTCACCTTTAAGGTTT TCAGTTCATCATTCTTTAAAGTCCATGAAAATGATCTCTATGGCTTCTGTGGCTCCAAAC CACTTCCCCACACACACCCACCTTCAGTCTTTTGAAAACCCACCAGTTACTCTCTTTGAG AACTGCAAGTCCATGGACCAACTCAAGCAAATCCATGCCCAAACAATGAAAACAGGCCTC ACAGCACATCCAATGGTGCTTAACAGAATTATAGTCTTTTGTTGTACTGATGAATTTGGC GACATGAAGTATGCCCGTCGGGTGTTTGACACAATTCCTGAACCAAGTGTTTTTCTTTGG AATACCATGATGAAAGGCTATAGTAGGATACGTTACCCTGATTATGGGGTTTCTATGTAT TTCACAATGCAAAGGTTGAGTGTCAAGCCCGACTGCTATACGTTCCCATTCTTGTTGAAG GGATTTACACGTGAAATTGCTTTGGCATGTGGCAAAGAGTTGCACGCTTCTGTGTTGAAG TATGGGTTTGATTCTAATGTTTTTGTTCAAAATGCATTGGTGCACATGTATTCTATTTGT GGTTTAATTGATATGGCACGTGGGGTTTTTGATATGATTTGTGAGAAGGAGGTTGCTACT TGGAATGTAATGATTTCTGGGTACAATAGAGTCAAGAAGTATGATGAATCCTGGAAGCTC TTCAATTGCATGCAGAAAAAGGGAGTATTGCCCACTTCAGTTACTCTTGTCTCAGTGCTA TCAGCCTGCTCCAAATTGAAGGATTTAGATGCCGGGAAACAGGTTCATAAGTGTGTCAAG GAGTGCCTGATCGAACCCACTTTAGTTTTGGAAAATGCTTTGGTTGATATGTATGTAGCT TGTGGGGAAATGAATGCTGCGCTTGAAATTTTTGAAAATATGAAAACTAAGGATGTAATT TCTTGGACTACAATTGTTAAGGGGTTTGCCAATTCAGGACAAGTTGATTTAGCTCGAAAC TACTTCGATGAGATGCCAGAAAGAGACTATATTTCATGGACTGCAATAATAGATGGGTAC CTCCAGGTAAACCGGTTCAAAGAGGCATTGGAACTTTTCCGCCAAATGCAGACTTCATGT GTAAAACCAGATGAGTACACTATGGTAAGCATTTTAAAAGCCTGTGCACATCTAGGAGCG CTTGAACTAGGAGAATGGATAAAAACCTACATTGACAAAAACAAGATCAAGAATGACACC TTTGTTAGAAATGCTTTAATAGACATGTATTTCAAGTGTGGAAATGCTGAAAAAGCTTTG AGGGTTTTTGATGCGATGCTTCATAGGGACAAATTTACATGGACGGCAATGATTGTTGGC CTTGCTACTAATGGACATGGTAGAGAAGCTCTTGGCATGTTCTCTCGGATGGTAGAATCT TTGGTAACTCCAGACCAGATAACTTTCATTGGTGTTCTCTGTGCGTGTACTCACTCTGGC ATGGTAGATGAAGGAAGAAAGTTTTTTGCTAGTATGATCACCCAACATGGGATTGAGCCT AATGTTACGCATTATGGGTGCATGGTGGATCTTCTTGGCCGAACAGGGCATCTAATCGAA GCTTTTGAGGTTATACAGAATATGCCAATGAAACCGAATTCAGTTGTGTGGGGAGCTCTT CTTGGTGCTTGTAGAATGCATAAAGATGCAGAACTGGCTGAAATGGCAGCTAAAAAGATG CTCGAGTTGGAGCAGGACAATGGGGCTGTTTACGTTCTCTTGTGCAATATATATGCAGCT TGCAATAAATGGGAAAATTTGCGTGAAGTCAGGCAAATGATGATGAATAGGGGAATCAAG AAAACCCCCGGTTGCAGTTTGATAGAGTTGAATGGTATTGTCCATGAGTTCGTAGCTGGG GATCGGTCACATCCTCAATCCGAAAAAATCTATTCCAAGTTGGATGAAATGATCAAAGAC TTGAAATTTGCAGGGGGAGGAGGATATAAAGAGAATGCAGTATGCAGGCACAGAGAGAAG TTAGCAATTGCCTTTGGACTGATCAGCTCAGGACCTGGTGTGACAATTAGAATCATGAAT AATCTTAGAATCTGTATGGATTGCCACAGCATGGCAAAGTTGGTCTCCAAGGTTTATGAT AGAGAGGTGATTGTTAGGGATGGAACTCGTGAGACAGGAACAGAAAAGTATAGAGAGATG AAGTTCAAGGCATTTCTTACGGAGAATGGTGTAAATCTTTTGGAAAAGAGGTTCCTACCA GCACTAGACAAGATGGGAAAGATATGCCATCTCTACCTCAATAGAGACCATGCTATCTTC CTCCACAACCTTCTCAATGGTGATGGAGTTCAGTCTATTGCTCAGTTTCGCAAAGAAGCT CTTTTCGATGACTATCGTATCTCCAGCCAGAATGAGGACCGCATTGCCTTTGCAGTGGAC ATTTCTCTTCTCCACCGTGCTCTTCGTAGTAGTGTCAGCATCTGTACTGAGTTTGGAAAT GGGCCTACCGCCAATCGTCTCCAGATTAAATTGGTTAAGAAGCTGCCTCCAAATTCTACT CAACCAATGCCTTTCCTTACTTTTGAGACCAAGGGTTATAAATCTGCTGTAATTCAGGAT GTGCCAATCTCAAAACCTTTGTCCAGAGCTCAGGTTCTTGAACTTCAAACTGCTCTTGAT ATGGCTCAAGATTTGCCTCAGACTCTGGTTCAGGTTCCGGATTTGAATCAGTTGCAGAAC TTTGTGGATCGGATGAGGCATGTGGGCGAGTTGCTCAATATTTCCATAAGTAAGTATGGG GATTTACACATTCAGATTTCCACAACATTAATCACACTTGGTGCTGAGTTTCAGAAGCTG TTGGTCTTAGGTGAAAGAGCTGATGCTCCATCTGAAGATCAAAACCTCAGTGCTCAGACT CGGTCAGCAAGGGCGATTTTGAGGGGAGATGCTCAATCTGTGCAAGTGAGTGTGAAGCAT TTTGGCAAGAGCCTTCAGTGTCACTTGGCTAAGCCGGATTGCGCTTTCTATGGGATCACT CCGCAAGGTGCTTGCTTGACAGTGATCTTCCAGTTTTTCATTCCTGGTTCCCATCAAATG GACAAGTCAATCAGTCTACATTGCAGACTTCCTGTACTGGACCAAGGGTCAGGTTGA
PEP MTFFLALKVKTHWLYSPLRFSVHHSLKSMKMISMASVAPNHFPTHTHLQSFENPPVTLFE NCKSMDQLKQIHAQTMKTGLTAHPMVLNRIIVFCCTDEFGDMKYARRVFDTIPEPSVFLW NTMMKGYSRIRYPDYGVSMYFTMQRLSVKPDCYTFPFLLKGFTREIALACGKELHASVLK YGFDSNVFVQNALVHMYSICGLIDMARGVFDMICEKEVATWNVMISGYNRVKKYDESWKL FNCMQKKGVLPTSVTLVSVLSACSKLKDLDAGKQVHKCVKECLIEPTLVLENALVDMYVA CGEMNAALEIFENMKTKDVISWTTIVKGFANSGQVDLARNYFDEMPERDYISWTAIIDGY LQVNRFKEALELFRQMQTSCVKPDEYTMVSILKACAHLGALELGEWIKTYIDKNKIKNDT FVRNALIDMYFKCGNAEKALRVFDAMLHRDKFTWTAMIVGLATNGHGREALGMFSRMVES LVTPDQITFIGVLCACTHSGMVDEGRKFFASMITQHGIEPNVTHYGCMVDLLGRTGHLIE AFEVIQNMPMKPNSVVWGALLGACRMHKDAELAEMAAKKMLELEQDNGAVYVLLCNIYAA CNKWENLREVRQMMMNRGIKKTPGCSLIELNGIVHEFVAGDRSHPQSEKIYSKLDEMIKD LKFAGGGGYKENAVCRHREKLAIAFGLISSGPGVTIRIMNNLRICMDCHSMAKLVSKVYD REVIVRDGTRETGTEKYREMKFKAFLTENGVNLLEKRFLPALDKMGKICHLYLNRDHAIF LHNLLNGDGVQSIAQFRKEALFDDYRISSQNEDRIAFAVDISLLHRALRSSVSICTEFGN GPTANRLQIKLVKKLPPNSTQPMPFLTFETKGYKSAVIQDVPISKPLSRAQVLELQTALD MAQDLPQTLVQVPDLNQLQNFVDRMRHVGELLNISISKYGDLHIQISTTLITLGAEFQKL LVLGERADAPSEDQNLSAQTRSARAILRGDAQSVQVSVKHFGKSLQCHLAKPDCAFYGIT PQGACLTVIFQFFIPGSHQMDKSISLHCRLPVLDQGSG


| Top |