Cherry SNP DataBase

Gene information

Gene Pav_sc0001369.1_g630.1.mk
Chromosome name PAV_r1.0chr3
start 6292378
end 6295925
PAV_r1.0 name Pav_sc0001369.1
start 272101
end 275648
direction +
Annotation NR Uncharacterized protein isoform 1
Sequence CDS ATGGTGGCGACAACTGCCTCAGCCACAGACGATCTGGAATATCTGGGGAAGGTTGTAGCT GGTTCCATTGTGGCTTCAGCTGTTATAAAGTATGGAAGCATAGTTTTTCCTGAGATAACC AGACCCAACATCGTACAGGCTCTTATCATGATATTAACTCCTGTTATTGTAGCCGTTTTG CTTTTGATCAAGCAGAGCCGTGCAGAGGGGCGAAGCTAG
PEP MVATTASATDDLEYLGKVVAGSIVASAVIKYGSIVFPEITRPNIVQALIMILTPVIVAVL LLIKQSRAEGRS


| Top |