Cherry SNP DataBase

Gene information

Gene Pav_sc0001392.1_g130.1.mk
Chromosome name PAV_r1.0chr6
start 2405818
end 2411429
PAV_r1.0 name Pav_sc0001392.1
start 60442
end 66053
direction -
Annotation NR PREDICTED: chloride channel protein CLC-f
Sequence CDS ATGTCAGGAGAGGACGAGGCTCTTCTCCTGAGATCCTCAAACGACATTAACAAAGACGAA AATGGTGGCGCTTCTGCCGAGAACGACAGTGATTTGGAAGCTCAAGATGGAATGAGCGGC AGAAAGAACAGTATCAGTCCGACCAGTAGAAGAGGAGGCGTCGGAGGCTTCAAAGATCTG CTGATCAAGCATTTGGACGGCGCAGGAGGGCTCTCCGGTCGCCGGCTCAGTTTCAAGCGC GGTAGAGAAAACCACAATCACAGAGAGATTAGAGAGCCGCGTTCCCCTGTAGATCCCCAC CATCAACATCATAATCATCAGCAGCATCATGAGCCCTTGGCCGGCATGGATGGGAATGAT GAGCTTGCCGATAGTGCCCCTCCCGAGTGGGCTTTGCTTCTCATTGGTTGCCTTCTCGGC CTCGCCACCGGTCTCTTTGTCGCGGCTTTTAACAAAGGGGTACATGTTATACATGAATGG GCCTGGGCTGGTACTCCAAATGATGGTGCTGCATGGCTCCGTCTGCAGAGACTGGGTGAT ACTTGGCATCGAATTCTTTTAATACCAGTCACAGGTGGGGTTATTGTTGGCATGATGCAT GGTTTACTTGAAATATTGGACCAGATAAGGCAGTCCAGTTCCTCTCAAAGACAGGGTTTT GATTTACTTGCTGGAGTTTTTCCCACAATAAAGGCTGTCCAGGCGGCTGTCACTTTAGGT ACTGGTTGTTCTTTGGGTCCTGAAGGCCCTAGTGTAGATATTGGAAAATCTTGTGCCAAC GGATTCTCATTAATGATGGAAAACAACAGAGAAAGGAAGATTGCCCTTGTTGCAGCAGGT GCAGCGGCTGGAATTTCTTCAGGGTTTAATGCAGCAGTTGCTGGTTGCTTCTTTGCTATT GAAACCGTGTTAAGGCCTCTTCGAGCAGAAAATTCACCTCCATTTACAACTGCAATGATT ATATTGGCTTCTGTTATATCATCCACCGTATCTAATGTTTTACTTGGGACTCAATCAGCC TTTACTGTGCCCACATATGATTTGAAATCTGCAGCTGAACTACCTCTGTACCTGATATTG GGCATGCTATGTGGTGCTGTAAGTGTAGCCTTCACTCGCTTGGTTGCTTGGTTCACAAAG TTCTTTGACTTTATCAAGGAAAGATTTGGCCTTCCTGCTGTTGCCTGCCCTGCATTAGGT GGTTTAGGAGCTGGTATAATCGCTCTTAAGTATCCTGGAATTTTGTACTGGGGTTTCACA AATGTTGAAGAAATCCTGCATACTGGGAGGATTGCTTCGGCTCCTGGAATCTGGCTGTTA ACTCAATTGGCAGCAGCCAAAGTTGTGGCAACAGCTTTATGCAAGGGTTCTGGGCTTGTA GGTGGCCTATATGCACCAAGCTTGATGATTGGTGCTGCTGTTGGTGCTGTGTTTGGGGGT TCAGCTGCAGAACTGATAAATTCAGCCATTCCAGGAAATGCTGCTGTTGCCCAGCCACAG GCTTATGCACTGGTTGGAATGGCTGCTACACTAGCTTCAGTTTGTTCGGTGCCATTGACA TCAGTCCTACTTCTGTTTGAGCTGACAAAAGATTACCGGATATTGCTTCCTCTCATGGGA GCTGTTGGATTGGCAATTTGGGTTCCCTCTGTGGTAAACCAGCCAATGGAGACTGAACCA TCTGATACACAGAATTCAGCAAGAGTATATTCTGTTGTTTCGGCCGCTGAAGAGAAAGAT GAAGTTATGCGGAGACAACTTGATAGTGGACATGATTTGGAACTCTCTGTAATAGGAAAC ACTTCTGACTCCGAAACAGTTAGTGAAGAATTGCTTCTGGAAGATCTAAAGGTTTCACGG GCCATGTCAAAGAACTATGTGAAAGTTCCTGTGAGTGTAACTATGAAAGAGGCAATAAAA TGCATGCGTGACAATCATCAGAATTGTGTGTTGGTGGTTGATGATGAAGATCTTCTTGAG GGAATATTAACATTTGGTGATGTTAGACGGTTTCAATCAAAGAAGTCTAGCGATACATCC AAGAGCGATTGTAGATTTTTGGACGCAAATACATGCCTTGTTTCCTCTGTTTGTACTCGA GGAATTAGCTATTGTGGGCGAGCACGTGGTATATTTACCTGTTATCCGGACACTGATTTA GCAATGGCCAAGGAACTAATGGAGGCGAAAGATATCAGGCAGTTGCCTGTGGTTAAGCGT GTCAGAGAACCATCAAAAGAAATAAAGCGAAGAATAGTAGCTATTCTTCATTATTCTTCA ATCTTGAACTGTCTCAGAGAGGAGATTAAATCACAGGAAATCAGTCCATCAACATAG
PEP MSGEDEALLLRSSNDINKDENGGASAENDSDLEAQDGMSGRKNSISPTSRRGGVGGFKDL LIKHLDGAGGLSGRRLSFKRGRENHNHREIREPRSPVDPHHQHHNHQQHHEPLAGMDGND ELADSAPPEWALLLIGCLLGLATGLFVAAFNKGVHVIHEWAWAGTPNDGAAWLRLQRLGD TWHRILLIPVTGGVIVGMMHGLLEILDQIRQSSSSQRQGFDLLAGVFPTIKAVQAAVTLG TGCSLGPEGPSVDIGKSCANGFSLMMENNRERKIALVAAGAAAGISSGFNAAVAGCFFAI ETVLRPLRAENSPPFTTAMIILASVISSTVSNVLLGTQSAFTVPTYDLKSAAELPLYLIL GMLCGAVSVAFTRLVAWFTKFFDFIKERFGLPAVACPALGGLGAGIIALKYPGILYWGFT NVEEILHTGRIASAPGIWLLTQLAAAKVVATALCKGSGLVGGLYAPSLMIGAAVGAVFGG SAAELINSAIPGNAAVAQPQAYALVGMAATLASVCSVPLTSVLLLFELTKDYRILLPLMG AVGLAIWVPSVVNQPMETEPSDTQNSARVYSVVSAAEEKDEVMRRQLDSGHDLELSVIGN TSDSETVSEELLLEDLKVSRAMSKNYVKVPVSVTMKEAIKCMRDNHQNCVLVVDDEDLLE GILTFGDVRRFQSKKSSDTSKSDCRFLDANTCLVSSVCTRGISYCGRARGIFTCYPDTDL AMAKELMEAKDIRQLPVVKRVREPSKEIKRRIVAILHYSSILNCLREEIKSQEISPST


| Top |