Cherry SNP DataBase

Gene information

Gene Pav_sc0001392.1_g270.1.mk
Chromosome name PAV_r1.0chr6
start 2470489
end 2477858
PAV_r1.0 name Pav_sc0001392.1
start 125113
end 132482
direction +
Annotation NR PREDICTED: uncharacterized protein LOC103344555 isoform X1
Sequence CDS ATGTTATCCGTTGAAAACCTTCCACCAGATCCCCCATGTCATCCACAAGCACTGATCAAA GATAGTAGTGATGATGAGAAGGCCTCTCAAACTCCATCCTTTCCAGAGGTAGTAGATCTA TCAAAGCCACCCCTTCCCAAGTTCTCCATAAGAGATTATGTTTTTACTTCACGGAGCAAG GATATCCAGACCAACTGGCCTTTTTCCCAGAAGAATTTGCAACTTTGTTTGAAACATGGC GTGAAGGATCTGTTGCCACCATTTCAAAGTCTTGATGCAGCAAAGAACCAATCCATTACG AGATGTACTGTTGAAAATGAAAACAAAAGCAATCTTGATATTGCAGAATCTTCTGGACAT GATGATCATGTAGTATTAGACTCGTCCAACAATACTATACTGAAGGAGAAGCTAGCAGAA GCTTGCACGGACACAACAACAACTTCATGCAGGTCTGAAGGAGAAAATGATTTTCCATCC ACAACTACAAGCATTTCTCAATCTGAAATAGAAGAGTCAGTTCCTACCAACAGGCAATCA AGCCCACTGTTAAGAACTGGTACTTCATTGGAAGCTGCCTCAGTTGAAGTTAAAGCTGTA AGTCTTCCTGTTGTTGTTGCCAACAAGAGAGAAAGCAAGACCCGACCCTCGGGTAAGAAG TGCAGATTGGTAGTAAAATTCAGTAGCCCCTCCGAGAGAAGCTCAACTGAAGATATTGCT TCAAATTGTACTGCCGTTTCAGAAACAATGACTTCAAAAATTTGCCCTGTTTGCAAAACC TTCTCATCGTCTTCTAATACCACCTTGAATGCTCATATTGATCAGTGCCTTTCCGGGGAG TCAACTCCCAAGTGGACTGTGGATTCTAATAAACTAACAAGGCACAGAATTAAGCCAAGG AAGACCAAATTGATGGTGGATATATATACTACTGCTCAGCATTGCACATTAGAAGATCTT GATAGAAGAAATGGTTCCAGCTGGGCCACTAGTGTTTCAAGCTTTCCTACTCAGGATAAT GAGCACTCTGAGATGCCTGTTGAAGAGAAAAGGCAAAGAGTGTCCTCAGCCCATCCTGAT GATATCGATGTTGGTGCAGTCTATGTGGACGCCAATGGCACCAAAGTTAGGATTTTATCC AAGTTTGATGATGCGCCATCTCCATCAGTGCCTAAAGTGGTAGAGCATCTTCGACCAAGA AAACCTTTGAAACGGGGTAAAGGAAGCAAATTCCTTTCAGCCAAAAAGCAAAAGCGCCAT GCATCTAAACATCACAAGTACCTTAAACTTGCTCCTCAAAGCAAAAACTTTTTCTCTTCC AAGGCTCATTCTTCTCAGATTCATGGGGGCCAAGAAAGATATGGAGTGAAAGAAAGTTCC AAGGACGAGGGACAGCAAATGGAGAAGCAGGCCAATTCCTGCAATCCTGGAGCTTTAAGA CGATGGGCTTGCTCCAAACGGACTGGTGTTGTAAAGAAGTTGAACAAGAAGCATGTGTCT CAGAATTTTTTGGTTGAGGGTGATCAAAGAGGTTTAGATAACTGTCTTGTGGAGAGAAAC CATGCTATAAAACCAATGAATTTTTCTGGAGATCAAAATTCTTCTCCAGAAAAAAGTGGG AGCACAGAGAATGTATATTATGAAGCTCAAGACAGTGACAAGAGTGACTGCTCTCCTGGA AGAAAGAGAGCAGGAAGTCCCTTTCCTGGTGCTGATATCAGTGATAATCTTGAGAGGTCC CTTCAGCGAAACTCCCATCAGTTTAGTAAAGACAGAAATTTTGCTCCTGATAGTTGCAAC CTGAACCTTACAAACTCTGACGGGAACTTTGCACCTTTGAGCAACAATAAAGTTGGTTCT GCTGCAGGTCTATGTGAAAATTTTGATAGTCCTCCAGATGCTAGCACAAAACCATCTAAG AGTCGTGATGCCTCCAGATCAAATGCCATGAAATCCCCCTTACCAAAGAAAAATGTGTTG TCTGTTGGCGGTGGGCTATCTTTGACTGAATCCAATTCCATTGTGGCTAAAAGCCCAGCT GTTAAGAATCAAGTGCATGAAAGGGTAGAAGTTGATAAAGAGGTTGCTCCCCGGAATTCT GAGCCTGATCAACGGTATGATTTCATGTATAATTGTGCTGGAAAGCGGTCTAGAAGAGGA GATATTACTGACGAAATATCTATTTGCAGAAACACTGTGTTGCAAAGGAGACAAAATAGA GGTTCCATAAGTATCTCTGGAAGGAAAGAAACCTTGGCCTCGAAGAGTTCACAATTTGCA TCTGAGCGTTATGGACATGATGAGAGGGAAAGTATGGATTCTTCTGTTAGAGTTGATGGC TTGGGAGTCGCTCAGGAGGATCAAATCCTCGGTAATGACATTGTTACTGAAACGTCTTCC CTAATAGGTGTTGGGGAGACCGTTGCTAGTTTTTGCAATACAGTAGATCCTGAACTTCAC ATACCGAGTGGCCGTTTCAAAGCCAAATCCGACTGTCAAAAATATAAGGGACCTTTTTCC GAATCTGAAGCACTGGCAAGTCCAGCTGATCCAAGAATTAGTAACGAGCAAGAGATGTTT TCTGCTGATGAAGTGGAAGACGCCCCACTCGGGCAGAATCTTAGTAATGCCGACGAAATG GACTCGGAAGTTGGCCAGGGAAGCTATTTTCCTGAGGTTGATCCAATACCTATTCCAGGG CCACCAGGATCATTTTTGCCAAGTCCTAGAGATATGGGCTCAGATGATTTTCAAGGGAAC TCTTCACTAACCACGAGCCGAGTTCAATCATCTCAAGATCAGCTTGATTTCATTGATGGG GATTCATCAGATTCACCTCTTTCTACAACATCAACCATCTCTAATTCCACTGGGACAAAA TGTGATCTGAAGTATTCTGAACCATTATCATCTATAGGACCTCAATCAGTTCAAGACAAC ATCAGGTCGGGCTTATCACATGCAATCATTGATCCTTGTGTAGAAATTAATGCTGCTGCA GCTCAACAGATAACTGGTATAGCAGCAGAAAGACTTGCTTTTGATAGAGAGAACTTTAAA GTCAACAAGACATCTCTTGAGAGGGGACCTCTCAGCTTCAAAGGTAACGATCAACCTTGC TGTTGTCAAAGAAAGGAGAGAACCTTTCAGGGTGTGGCTTTAAATTATCAAGAATCACCA CTATTAAGGCGACGAGCAATGGCACTGCCTGCCATGGGAAAGCAAGTGGGTTGCAATCCA AACACAAGAACCAACAATGTGGAGACGAGGTCTGACATGACAGACACCTTCTTTCCGAAT GGTTTCCCAACTTCAAGATCTGAACAGATGGTTTTCCCTGTCACTAAGTCATCTACAGGT TCCATTCCTTTGAAGGGTTCTCCAGATGGCAAAGGGAAGTTTTCTGGTCACAGTGATTGT GATTCTGTTAGTCCATCTGCTTCTAATTCCGTACTCCGGCTGATGGGAAAGAATTTGATG GTGGTCAATAGAGATGAAGATGCATCAGCTCCGCCGGTGCAGGCTCAATCACATGCCCCA ATTAACCATCTAACTTCACAGTTTCCAACATTCTCAGGAGTTGTTCCTGGCAATCAAAAT CAGTTTTACCATTCCTTCCATCATAGTCTTCCTCATGGTTCAGTTATCTTTGGTCAAGAT CCCCATAACAAAGTGGGGGAATGTTTTGATGCAGCGCACTTCAACAGTTTTAGAAGCTAT AGCAATCCGAAGACACCACAAGTGGTTGCACGAGGACCTGTAAGCTTGTTTTCACAGCAG CATACAGATGGTGGTTTTGTGGCATCCATGGAATCTCATGAGTATAAAGGTGACTACAAT TTTCCAATCCCACAGAACAAGAATATAAGCAAACCCATTGGAGCACCCGCATTTCAAATG GAGAGAGTTATGAACACTCCGGACCACCGACGCAAGAATTCAGATTCTGCTTCCAGTGCA AATAAAGAGATTATCATCATTGATGATCCCGAAAGTGAACCAGATTTGGCCTGTAATGTT TCAAACTACTCAGAAGGGTCGAGGGAAGGCCAAGTAGTGTGTTCTGGCATTCCAGTTCCA GCAGCTCCCAGTTATAACTCACAGCGTGTGAATCCTTTCTCCTGTTATGAGTCACAGGAC CCTTCTCTTCTCTGTGGATCACCAGTTTTGTACAACACCGCCTTGCATGCAATTCCCTCC CGACGAGCCAATGCAAGTCCTGCCCGGTGGAGTTGTACTTCAGAAGGTTCTGGTGTGCTG CAGCGGACTCCTTTTCTTGCAGCATCGTCATCTTCAAGAAGTCATCTGAGACCTACAGTT TACAATTCTCCGAGCTTGTCATAG
PEP MLSVENLPPDPPCHPQALIKDSSDDEKASQTPSFPEVVDLSKPPLPKFSIRDYVFTSRSK DIQTNWPFSQKNLQLCLKHGVKDLLPPFQSLDAAKNQSITRCTVENENKSNLDIAESSGH DDHVVLDSSNNTILKEKLAEACTDTTTTSCRSEGENDFPSTTTSISQSEIEESVPTNRQS SPLLRTGTSLEAASVEVKAVSLPVVVANKRESKTRPSGKKCRLVVKFSSPSERSSTEDIA SNCTAVSETMTSKICPVCKTFSSSSNTTLNAHIDQCLSGESTPKWTVDSNKLTRHRIKPR KTKLMVDIYTTAQHCTLEDLDRRNGSSWATSVSSFPTQDNEHSEMPVEEKRQRVSSAHPD DIDVGAVYVDANGTKVRILSKFDDAPSPSVPKVVEHLRPRKPLKRGKGSKFLSAKKQKRH ASKHHKYLKLAPQSKNFFSSKAHSSQIHGGQERYGVKESSKDEGQQMEKQANSCNPGALR RWACSKRTGVVKKLNKKHVSQNFLVEGDQRGLDNCLVERNHAIKPMNFSGDQNSSPEKSG STENVYYEAQDSDKSDCSPGRKRAGSPFPGADISDNLERSLQRNSHQFSKDRNFAPDSCN LNLTNSDGNFAPLSNNKVGSAAGLCENFDSPPDASTKPSKSRDASRSNAMKSPLPKKNVL SVGGGLSLTESNSIVAKSPAVKNQVHERVEVDKEVAPRNSEPDQRYDFMYNCAGKRSRRG DITDEISICRNTVLQRRQNRGSISISGRKETLASKSSQFASERYGHDERESMDSSVRVDG LGVAQEDQILGNDIVTETSSLIGVGETVASFCNTVDPELHIPSGRFKAKSDCQKYKGPFS ESEALASPADPRISNEQEMFSADEVEDAPLGQNLSNADEMDSEVGQGSYFPEVDPIPIPG PPGSFLPSPRDMGSDDFQGNSSLTTSRVQSSQDQLDFIDGDSSDSPLSTTSTISNSTGTK CDLKYSEPLSSIGPQSVQDNIRSGLSHAIIDPCVEINAAAAQQITGIAAERLAFDRENFK VNKTSLERGPLSFKGNDQPCCCQRKERTFQGVALNYQESPLLRRRAMALPAMGKQVGCNP NTRTNNVETRSDMTDTFFPNGFPTSRSEQMVFPVTKSSTGSIPLKGSPDGKGKFSGHSDC DSVSPSASNSVLRLMGKNLMVVNRDEDASAPPVQAQSHAPINHLTSQFPTFSGVVPGNQN QFYHSFHHSLPHGSVIFGQDPHNKVGECFDAAHFNSFRSYSNPKTPQVVARGPVSLFSQQ HTDGGFVASMESHEYKGDYNFPIPQNKNISKPIGAPAFQMERVMNTPDHRRKNSDSASSA NKEIIIIDDPESEPDLACNVSNYSEGSREGQVVCSGIPVPAAPSYNSQRVNPFSCYESQD PSLLCGSPVLYNTALHAIPSRRANASPARWSCTSEGSGVLQRTPFLAASSSSRSHLRPTV YNSPSLS


| Top |